BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A07f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35603-3|CAA84675.1| 433|Caenorhabditis elegans Hypothetical pr... 28 4.7 AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical ... 27 6.2 >Z35603-3|CAA84675.1| 433|Caenorhabditis elegans Hypothetical protein T02C12.3 protein. Length = 433 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 373 CAFGQKKFIDMSIQIYLNIIVSFKEYGSKP 284 C FG D + +Y I+VSF+++GS P Sbjct: 290 CKFGYDPRTDRNGGLYQTIMVSFRQHGSIP 319 >AF016443-3|AAC24281.1| 395|Caenorhabditis elegans Hypothetical protein C17E7.7 protein. Length = 395 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 2/54 (3%) Frame = -2 Query: 337 IQIYLNIIVSFKEYGSKPALNKG**LTCYLSKMSFRRVL*LPMEY--KVNNSFF 182 +Q Y +II K++GS+P LTC KM FRRV+ +EY K +N+ F Sbjct: 52 MQKYSDII---KDFGSQPKQV----LTCDACKMFFRRVVTEKLEYTCKCSNNCF 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,847,410 Number of Sequences: 27780 Number of extensions: 210769 Number of successful extensions: 415 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -