BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1119 + 27760412-27760527,27760851-27761010,27761283-277614... 27 6.9 09_03_0118 - 12492206-12492415,12492746-12492816,12493611-124936... 27 9.1 >06_03_1119 + 27760412-27760527,27760851-27761010,27761283-27761449, 27761525-27761629,27762097-27762864,27762942-27763131, 27763763-27763940,27764106-27764497 Length = 691 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 45 FFVTFILTLSSPPDTPQCEFSFETRGSNLNCS 140 F+ ++L +S P+ PQ S+ + GSNL+ S Sbjct: 226 FYHLWLLAQTSSPENPQLIASWPSNGSNLSLS 257 >09_03_0118 - 12492206-12492415,12492746-12492816,12493611-12493634, 12494061-12494114,12494803-12496345 Length = 633 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 Query: 418 IHS*YLRIYYLLICNL 465 IHS +LR+ YLL CNL Sbjct: 550 IHSTFLRVKYLLSCNL 565 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,693,869 Number of Sequences: 37544 Number of extensions: 144549 Number of successful extensions: 304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -