BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A04f (501 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0649 + 30861946-30862179,30862702-30862824,30863104-308631... 29 1.6 06_03_0988 + 26642247-26642506,26642790-26642872,26643150-266432... 28 4.8 07_03_0476 - 18547223-18548187,18548743-18549958 27 8.5 >01_06_0649 + 30861946-30862179,30862702-30862824,30863104-30863197, 30863819-30863901,30863984-30864073,30864176-30864562, 30864903-30864991,30867801-30867907,30868431-30868822 Length = 532 Score = 29.5 bits (63), Expect = 1.6 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +3 Query: 180 HHVDDYVELLYDDIPEKIKGSALILQLA 263 H VD+ V L + +P++IK SA LQLA Sbjct: 373 HLVDNRVVFLLESVPDEIKDSARSLQLA 400 >06_03_0988 + 26642247-26642506,26642790-26642872,26643150-26643238, 26643478-26643551,26643783-26643833,26644512-26644588, 26644694-26645313 Length = 417 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 219 YHHIIILHNHQHGAKQQQDHFP 154 Y ++ LH H H +QQQ FP Sbjct: 285 YWSLLALHYHHHQQQQQQQQFP 306 >07_03_0476 - 18547223-18548187,18548743-18549958 Length = 726 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 132 SRETMSPVESGPVAVLHHVDDYVELLYDDIPEKIKGSA 245 S E S +ES +L H+DD ++ Y DI + S+ Sbjct: 650 SEEATSYIESQSSVLLKHLDDILQTGYPDIGNHVVASS 687 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,981,334 Number of Sequences: 37544 Number of extensions: 179124 Number of successful extensions: 372 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -