BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A04f (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_55425| Best HMM Match : CBM_14 (HMM E-Value=7.2) 29 2.8 SB_57570| Best HMM Match : CBM_14 (HMM E-Value=7.2) 29 2.8 >SB_12550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 850 Score = 62.1 bits (144), Expect = 2e-10 Identities = 23/37 (62%), Positives = 33/37 (89%) Frame = +3 Query: 327 VLREEWKRSIELSTNIVYTFFCFSTYNEFHPVIIQYK 437 V+RE+W++S EL+TNIVY FFCFS++++FH +II YK Sbjct: 122 VMREDWRKSSELTTNIVYMFFCFSSFSQFHTIIIHYK 158 >SB_55425| Best HMM Match : CBM_14 (HMM E-Value=7.2) Length = 138 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 408 HCRLRNKKMCIQYWYLVQCFVSIL 337 HCRLR +C+Q +LV VS L Sbjct: 95 HCRLRGSSICLQGLFLVALAVSAL 118 >SB_57570| Best HMM Match : CBM_14 (HMM E-Value=7.2) Length = 82 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 408 HCRLRNKKMCIQYWYLVQCFVSIL 337 HCRLR +C+Q +LV VS L Sbjct: 39 HCRLRGSSICLQGLFLVALAVSAL 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,352,174 Number of Sequences: 59808 Number of extensions: 225625 Number of successful extensions: 467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -