BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A03f (509 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X97196-1|CAA65830.1| 3429|Drosophila melanogaster hypothetical p... 28 8.4 AE014298-856|AAF46135.2| 3419|Drosophila melanogaster CG3585-PA ... 28 8.4 >X97196-1|CAA65830.1| 3429|Drosophila melanogaster hypothetical protein protein. Length = 3429 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 206 PSNRNALVLHGRNNFQRTVELIVRKII-IVRNKTDREENAHRNS 334 P+N+N +LH NN + L I+ + K EEN H N+ Sbjct: 443 PANQNVFILHWLNNKEMHFTLQAEAILQELTKKVIDEENGHGNA 486 >AE014298-856|AAF46135.2| 3419|Drosophila melanogaster CG3585-PA protein. Length = 3419 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 206 PSNRNALVLHGRNNFQRTVELIVRKII-IVRNKTDREENAHRNS 334 P+N+N +LH NN + L I+ + K EEN H N+ Sbjct: 436 PANQNVFILHWLNNKEMHFTLQAEAILQELTKKVIDEENGHGNA 479 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,113,069 Number of Sequences: 53049 Number of extensions: 402086 Number of successful extensions: 743 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 743 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1846255872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -