BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H11f (483 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 0.64 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 0.64 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 0.64 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 0.64 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 2.6 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 3.4 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 4.5 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 6.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 7.9 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 0.64 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 419 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 324 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 63 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 93 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 0.64 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 419 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 324 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 377 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 407 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.64 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 419 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 324 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 0.64 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 419 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 324 ++L +I+ + K G T +R+RPPK+ T + Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 2.6 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = -3 Query: 388 CRNVKV*LHYVCAHQRSW*QSLLQQVSECKYDEGWQHNAHRTNQ 257 C N++ C+ W L + +C Y EGW + +Q Sbjct: 200 CDNLQYSFDNQCSGTIDW---ALPKQEDCFYQEGWNGQSFDVSQ 240 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 480 CENATTVLNFLNKLQCL 430 CEN T ++ +N QC+ Sbjct: 77 CENGGTCVDKINAFQCI 93 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 480 CENATTVLNFLNKLQCL 430 CEN T + N+ QCL Sbjct: 108 CENQATCVQNKNQYQCL 124 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 380 CEGVTPLRLRPPKILVTVFTPT 315 C PL PP L +F PT Sbjct: 171 CNNYLPLPQVPPLPLPPIFAPT 192 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = -2 Query: 380 CEGVTPLRLRPPKILVTVFTPT 315 C PL PP L +F PT Sbjct: 171 CNNYPPLPQVPPLPLPPIFPPT 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,564 Number of Sequences: 336 Number of extensions: 2403 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11352204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -