BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H11f (483 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 0.98 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 1.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 1.7 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.1 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.1 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 0.98 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 NGQSQGT*AHGSCKDSSLQRAGSV 251 NG+ + AHG ++ +LQ+AG V Sbjct: 419 NGEFEVEPAHGEDREEALQKAGIV 442 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 273 HIEPIRVIRSQLFEASCLYKIHVLRYLDFA--RFF 175 H+E R+IR+ FE++ + + + +D A RFF Sbjct: 383 HVEVARLIRNYYFESNKIDETTLKHLIDVASDRFF 417 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 273 HIEPIRVIRSQLFEASCLYKIHVLRYLDFA--RFF 175 H+E R+IR+ FE++ + + + +D A RFF Sbjct: 383 HVEVARLIRNYYFESNKIDETTLKHLIDVASDRFF 417 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 20.6 bits (41), Expect = 9.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 145 CLVQHPLL*RNASCRRKLLFYC*ESFIVAVYSVYL 41 C +P + N + RRK LFY + V YL Sbjct: 218 CDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 314 LLE*RLSPRSLVGANVMELHLHISA 388 LL+ RL+P S + ++ H H+S+ Sbjct: 268 LLKARLNPNSSLQPSLASHHSHLSS 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,338 Number of Sequences: 438 Number of extensions: 2644 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -