BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0111 + 9257161-9257931 27 9.1 06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734,916... 27 9.1 >10_05_0111 + 9257161-9257931 Length = 256 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -3 Query: 363 HFTKIFNIYLLFKFRF*CSPCCLLSHGYNIKEFINNKYYSLLDDITKLIWH 211 HFT I+ L PC + G+ ++ ++ KY+S+ + WH Sbjct: 112 HFTLFRRIFFLKPQPNKSKPCVVGGAGFQLRGTLSQKYFSMPFKTSNKGWH 162 >06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734, 9166815-9167066,9167152-9168186,9168313-9169187, 9169476-9169673 Length = 898 Score = 27.1 bits (57), Expect = 9.1 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 94 HYDRKTFFSLILVLRIHLPS 35 HYD++TF + +L + +PS Sbjct: 809 HYDKETFMEFLTILNLSIPS 828 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,504,316 Number of Sequences: 37544 Number of extensions: 198924 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -