BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H10f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U77589-1|AAB51233.1| 255|Homo sapiens MHC class II HLA-DQ-alpha... 30 5.7 AY585236-1|AAT09985.1| 176|Homo sapiens MHC class II antigen pr... 30 5.7 >U77589-1|AAB51233.1| 255|Homo sapiens MHC class II HLA-DQ-alpha chain protein. Length = 255 Score = 29.9 bits (64), Expect = 5.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 332 SRYMLNIFVKC*LTKIICNNLESSNAFSKIDLNTNQNVSNVCLVSN 469 +++ LNI +KC + N + FSK + Q + +CLV N Sbjct: 92 AKHNLNIMIKCYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDN 137 >AY585236-1|AAT09985.1| 176|Homo sapiens MHC class II antigen protein. Length = 176 Score = 29.9 bits (64), Expect = 5.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 332 SRYMLNIFVKC*LTKIICNNLESSNAFSKIDLNTNQNVSNVCLVSN 469 +++ LNI +KC + N + FSK + Q + +CLV N Sbjct: 64 AKHNLNIMIKCYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDN 109 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,599,095 Number of Sequences: 237096 Number of extensions: 1147031 Number of successful extensions: 1929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1929 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -