BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 3.3 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 4.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 5.8 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 5.8 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 5.8 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 5.8 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 5.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 320 VFNVRPVAYYHMATTLRNSL 261 VFN+RP YH+ N + Sbjct: 939 VFNLRPATTYHLRIVAENEI 958 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +3 Query: 120 SSDHTASRALYRNHCKEKV*LEIIDVLKTFCAK 218 +S T S ALY + V ++ + + TFC K Sbjct: 308 TSSTTMSNALYELALNQDVQKKLREEINTFCPK 340 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDITKL 220 LS+ YN + NN Y L +I + Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNINHI 109 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDI 229 LS+ YN + NN Y L +I Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDI 229 LS+ YN + NN Y L +I Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDI 229 LS+ YN + NN Y L +I Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDI 229 LS+ YN + NN Y L +I Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 294 LSHGYNIKEFINNKYYSLLDDI 229 LS+ YN + NN Y L +I Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,000 Number of Sequences: 438 Number of extensions: 2569 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -