BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS307H10f
(521 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.1
DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 3.3
DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 4.4
DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 5.8
DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 5.8
DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 5.8
DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 5.8
DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 5.8
>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
Length = 1946
Score = 23.8 bits (49), Expect = 1.1
Identities = 8/20 (40%), Positives = 11/20 (55%)
Frame = -1
Query: 320 VFNVRPVAYYHMATTLRNSL 261
VFN+RP YH+ N +
Sbjct: 939 VFNLRPATTYHLRIVAENEI 958
>DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450
monooxygenase protein.
Length = 499
Score = 22.2 bits (45), Expect = 3.3
Identities = 11/33 (33%), Positives = 17/33 (51%)
Frame = +3
Query: 120 SSDHTASRALYRNHCKEKV*LEIIDVLKTFCAK 218
+S T S ALY + V ++ + + TFC K
Sbjct: 308 TSSTTMSNALYELALNQDVQKKLREEINTFCPK 340
>DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.8 bits (44), Expect = 4.4
Identities = 9/25 (36%), Positives = 13/25 (52%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDITKL 220
LS+ YN + NN Y L +I +
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNINHI 109
>DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/22 (40%), Positives = 12/22 (54%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDI 229
LS+ YN + NN Y L +I
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106
>DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/22 (40%), Positives = 12/22 (54%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDI 229
LS+ YN + NN Y L +I
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106
>DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/22 (40%), Positives = 12/22 (54%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDI 229
LS+ YN + NN Y L +I
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106
>DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/22 (40%), Positives = 12/22 (54%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDI 229
LS+ YN + NN Y L +I
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106
>DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/22 (40%), Positives = 12/22 (54%)
Frame = -3
Query: 294 LSHGYNIKEFINNKYYSLLDDI 229
LS+ YN + NN Y L +I
Sbjct: 85 LSNNYNYSNYNNNNYKQLCYNI 106
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,000
Number of Sequences: 438
Number of extensions: 2569
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -