BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H08f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101319-3|AAC69355.1| 331|Caenorhabditis elegans Hypothetical ... 29 1.5 Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical pr... 28 4.7 >AF101319-3|AAC69355.1| 331|Caenorhabditis elegans Hypothetical protein K08D9.5 protein. Length = 331 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -2 Query: 520 AGNYVKIIYRNYNLALKLGSTTNPSNERIAYGDGVD-KHTELVSWKFITLWENNRVYFKI 344 A +KII Y++ S NE A + +D HT + + +FIT ++N V F + Sbjct: 57 ANTMIKIIQNEYSI----DSLLETDNETSALIETLDVSHTFIEAAEFITFLDSNDVLFPV 112 Query: 343 HNTKYNQ 323 + Y Q Sbjct: 113 NYPTYTQ 119 >Z72504-5|CAA96602.2| 812|Caenorhabditis elegans Hypothetical protein C29E6.1a protein. Length = 812 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 171 STMPWSSVRS*TPRETARPLDTMVKSPVFLTST 73 ST ++ + TP+ + +P T KSPV +T+T Sbjct: 388 STKKLTTTTTTTPKPSQKPTTTTTKSPVVITTT 420 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,651,753 Number of Sequences: 27780 Number of extensions: 202993 Number of successful extensions: 767 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -