BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307H02f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-32... 56 2e-08 11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-30... 52 3e-07 02_05_0624 - 30451032-30451140,30451294-30451409,30451506-304515... 29 2.3 02_05_0448 - 29100674-29100716,29100821-29100902,29101010-291011... 29 3.0 01_06_1124 - 34679205-34680926,34681438-34682811 27 6.9 11_06_0707 + 26467214-26470309 27 9.1 11_06_0698 + 26385989-26389090 27 9.1 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 27 9.1 >12_01_0039 - 319871-319914,320021-320084,320198-320263,320397-320458, 321211-321298,321401-321461,321542-321625,322332-322630 Length = 255 Score = 55.6 bits (128), Expect = 2e-08 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 3/80 (3%) Frame = +1 Query: 268 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 447 C + +QI E AS Y ++ AYF D V GFAK F +++ EER+HA KL+ Y M Sbjct: 91 CEAAISEQINVEFNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLMKYQNM 150 Query: 448 RG---KLTGSVTNLITYRAP 498 RG +L VT L + P Sbjct: 151 RGGRVRLQSIVTPLTEFDHP 170 >11_01_0040 - 304439-304482,304589-304652,304766-304831,305509-305640, 305744-305804,305885-306018,306310-306654 Length = 281 Score = 52.0 bits (119), Expect = 3e-07 Identities = 31/69 (44%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +1 Query: 301 EVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG---KLTGSV 471 E AS Y ++ AYF D V GFAK F +++ EER+HA KLI Y MRG +L V Sbjct: 134 EYNASYAYHSLFAYFDRDNVALKGFAKFFKESSDEERDHAEKLIKYQNMRGGRVRLQSIV 193 Query: 472 TNLITYRAP 498 T L + P Sbjct: 194 TPLTEFDHP 202 >02_05_0624 - 30451032-30451140,30451294-30451409,30451506-30451580, 30452033-30452093,30452198-30452424 Length = 195 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 328 AMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLL 444 A+ YF + TV P A FF + +RE T L+D LL Sbjct: 115 ALPKYFQVGTVIEP--ASEFFSSRLTKRERKTTLVDELL 151 >02_05_0448 - 29100674-29100716,29100821-29100902,29101010-29101130, 29101481-29101546,29101628-29101735,29102083-29102148, 29102605-29102633,29102773-29102902 Length = 214 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -3 Query: 249 PLIPDGDGADVTLCSCGRS*GSNESEDSKENSPHLNFSYNHRFFDDIQKN 100 P+I G+ D + C D KE PH RFF+D +KN Sbjct: 129 PMIDQGEKDDKIIAVCADDPEYRHFRDIKEIPPH-RLQEIRRFFEDYKKN 177 >01_06_1124 - 34679205-34680926,34681438-34682811 Length = 1031 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 312 VNPVLSHGGLLLDRYGEPPRLREA 383 +NP + H G ++D G RLREA Sbjct: 355 INPDVKHFGCIIDMLGRAGRLREA 378 >11_06_0707 + 26467214-26470309 Length = 1031 Score = 27.1 bits (57), Expect = 9.1 Identities = 21/60 (35%), Positives = 28/60 (46%) Frame = -3 Query: 510 RRVGGGPVRDEVGYGACQLAPHEQVVNELGRVLAFFSRSIEE*LREAGAVHRIDREVSPH 331 R+ GG P+ V A LA EQ NE R+L + S+ + RE + EV PH Sbjct: 361 RKCGGLPLAIRVI--ATVLASQEQTENEWRRILGKNAWSMSKLPRELSGALYLSYEVLPH 418 >11_06_0698 + 26385989-26389090 Length = 1033 Score = 27.1 bits (57), Expect = 9.1 Identities = 21/60 (35%), Positives = 28/60 (46%) Frame = -3 Query: 510 RRVGGGPVRDEVGYGACQLAPHEQVVNELGRVLAFFSRSIEE*LREAGAVHRIDREVSPH 331 R+ GG P+ V A LA EQ NE R+L + S+ + RE + EV PH Sbjct: 361 RKCGGLPLAIRVI--ATVLASQEQTENEWRRILGKNAWSMSKLPRELSGALYLSYEVLPH 418 >06_03_0526 + 21771519-21771607,21771685-21771810,21771890-21772010, 21772123-21772851,21772954-21773349,21774594-21774665, 21774741-21774803,21775236-21775337 Length = 565 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 288 TDPGGSGRVNPVLSHGGLLLDRYGEPP 368 T G S +P HGGLL YGE P Sbjct: 185 TSVGASAAADPSPVHGGLLAPVYGEFP 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,735,249 Number of Sequences: 37544 Number of extensions: 253557 Number of successful extensions: 621 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -