BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307G12f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 25 0.36 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 25 0.36 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 1.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 3.3 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 3.3 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 3.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 3.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 3.3 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 7.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 25.4 bits (53), Expect = 0.36 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 157 MVQHL*YVPRMDLHQRLFDRLKKNTRPFYKDLKQRLI 47 +VQ+ Y+P+ + + LFD PF KD+ + +I Sbjct: 327 VVQYFGYLPQDMVGRSLFDFYHPEDLPFIKDIYETVI 363 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 300 SKRCSVGCSYRSSKWSCNRGYGRSE 374 S CS S RSS S +R RSE Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSE 42 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 25.4 bits (53), Expect = 0.36 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -2 Query: 157 MVQHL*YVPRMDLHQRLFDRLKKNTRPFYKDLKQRLI 47 +VQ+ Y+P+ + + LFD PF KD+ + +I Sbjct: 33 VVQYFGYLPQDMVGRSLFDFYHPEDLPFIKDIYETVI 69 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 508 AAAPSGCSXAXXXIRSXLYLRTFLHTLHKLI 416 A AP+GC +R YLR + +LI Sbjct: 362 ALAPAGCDLTIDNLRKAKYLRACITESLRLI 392 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 252 CCFAILCWCCSN 217 CC CWCC N Sbjct: 11 CC----CWCCDN 18 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 267 WSSKRCRTYWSSKRC 311 W S C YW++K C Sbjct: 98 WGS--CNNYWNTKNC 110 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 3.3 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -3 Query: 252 CCFAILCWCCSNPA 211 CC+ +CW + PA Sbjct: 488 CCWWKICWTITTPA 501 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 3.3 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = -3 Query: 252 CCFAILCWCCSNPA 211 CC+ +CW + PA Sbjct: 541 CCWWKICWTITTPA 554 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 3.3 Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 5/63 (7%) Frame = +2 Query: 107 QTLVQIHTGNVL-----EVLDHMGSRQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLE 271 +TL +H+ +L E M ++Q+ QQ+Q + + + + Q +Q + + Sbjct: 396 RTLNTLHSEKLLAFKMTEQQQQMQAQQQHQQQQQQTQHVINAQQPQQQQQQQQQQQQQQQ 455 Query: 272 QQE 280 QQ+ Sbjct: 456 QQQ 458 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 300 SKRCSVGCSYRSSKWSCNRGYGRSE 374 S CS S RSS S +R RSE Sbjct: 18 SNTCSNSQSQRSSGSSISRNSNRSE 42 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 173 RMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVP 286 + QQ+Q + ++P +Q Q + + +QQ+ P Sbjct: 1506 QQQQQQQQQQQPQQQSQQPQQQQPQPQQQQQQQQQQQP 1543 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,194 Number of Sequences: 438 Number of extensions: 2496 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -