BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307G11f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|c... 31 0.10 SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|... 27 2.2 >SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|chr 2|||Manual Length = 812 Score = 31.1 bits (67), Expect = 0.10 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = -3 Query: 414 VATTIVLCTYLNNVYITFVSEIRKSFCTERYY 319 + TT+ Y+ ++ +++S+IR+ +CT +Y Sbjct: 104 IGTTVGFAAYMLDIVTSWLSDIRRGYCTSHWY 135 >SPAC17D4.03c |||membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 732 Score = 26.6 bits (56), Expect = 2.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 391 YLLKQCIHNVCIGNTKIIL 335 YLLKQC+ N+ + N+ I L Sbjct: 652 YLLKQCLSNISLSNSVISL 670 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,998,663 Number of Sequences: 5004 Number of extensions: 38650 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -