BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307G10f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14250.1 68414.m01687 nucleoside phosphatase family protein /... 29 1.4 At1g14230.1 68414.m01684 nucleoside phosphatase family protein /... 29 2.5 At1g43650.1 68414.m05011 integral membrane family protein / nodu... 27 5.8 At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) fa... 27 7.7 >At1g14250.1 68414.m01687 nucleoside phosphatase family protein / GDA1/CD39 family protein low similarity to SP|P97687 Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (Ecto-apyrase) {Rattus norvegicus}; contains Pfam profile PF01150: GDA1/CD39 (nucleoside phosphatase) family Length = 488 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 213 ERIRRAHLNDLENIPAFWILGAFYVTT 293 ERI+ A ENIP W LGAF + T Sbjct: 444 ERIKYASKAGKENIPLDWALGAFILNT 470 >At1g14230.1 68414.m01684 nucleoside phosphatase family protein / GDA1/CD39 family protein low similarity to SP|P49961 Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (Ecto-apyrase) {Homo sapiens}; contains Pfam profile PF01150: GDA1/CD39 (nucleoside phosphatase) family Length = 503 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 213 ERIRRAHLNDLENIPAFWILGAFYVTTGPAATF 311 ERI+ A E+IP W LGAF + T ATF Sbjct: 452 ERIKYASKAGEEDIPLDWALGAFILNTA-TATF 483 >At1g43650.1 68414.m05011 integral membrane family protein / nodulin MtN21-related similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula]similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 343 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 321 LFRLFTVFRILHTIVYAVIPLPQPSR-AIAFGIPYIIMLYMGIQV 452 L L +F + + V+AV PS I FG+P + M Y GI V Sbjct: 209 LVALQCLFSCIQSAVWAVAVNRNPSVWKIEFGLPLLSMAYCGIMV 253 >At5g57750.1 68418.m07219 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 210 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 423 IIMLYMGIQVILYYVTAL*RLLVKY 497 I++LY+ + I+++V AL LLVK+ Sbjct: 35 IVLLYITLLSIIFFVAALIHLLVKF 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,846,190 Number of Sequences: 28952 Number of extensions: 214869 Number of successful extensions: 592 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 592 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -