BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307G09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_1080 - 11053879-11053881,11054140-11054244,11055158-110551... 29 3.0 09_02_0403 + 8590195-8590443,8590583-8590690,8590788-8590901,859... 27 9.1 >08_01_1080 - 11053879-11053881,11054140-11054244,11055158-11055174, 11055583-11055790 Length = 110 Score = 28.7 bits (61), Expect = 3.0 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +3 Query: 369 NF*ITVSNLLATGYQIYLSIIWN*HRFYRIPRGGARYPIRP 491 NF +TV+ L GY IYL + W RI GG P P Sbjct: 15 NFVLTVAGLAMVGYGIYLLVEW-----MRISGGGGGAPPSP 50 >09_02_0403 + 8590195-8590443,8590583-8590690,8590788-8590901, 8590998-8591210 Length = 227 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 343 FVSLKIVSTIFRSLSQTYWPRDTKSICLSF 432 F+ L+ +TI L T+WP T+S +SF Sbjct: 193 FLRLESPATISSELKSTFWPMLTESTDISF 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,553,860 Number of Sequences: 37544 Number of extensions: 228665 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -