BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 22 2.9 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 2.9 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 3.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 6.6 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +3 Query: 426 NNMCLKAQHTNAPLNNNHLDMPIWMLHIY 512 +N C Q N P++ H D W+ I+ Sbjct: 81 SNYCDNKQQANPPISTEHCD---WLYGIF 106 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 2.9 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -1 Query: 473 VVQGGIG--MLRLEAHIVGKHWKVHHPKPILLDQDL 372 V QGG + RLE H+ K W +P + Q L Sbjct: 223 VWQGGESEALARLERHLERKAWVASFGRPKMTPQSL 258 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 85 YNDLSHKSSTVRGVSYDRDEQI 20 Y +SH ++RGV Y D I Sbjct: 220 YGVVSHDDGSLRGVRYTADGTI 241 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 426 WEALEGPPPEADPSGPGLKS 367 W+A P P A P LKS Sbjct: 66 WQANSPPSPPAPSELPALKS 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,400 Number of Sequences: 336 Number of extensions: 2589 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -