BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F11f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 27 2.2 SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pom... 26 3.0 SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 26 3.9 SPBC3B9.08c |||Mago-nashi homolog|Schizosaccharomyces pombe|chr ... 25 6.8 SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ... 25 9.0 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 25 9.0 SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|c... 25 9.0 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 26.6 bits (56), Expect = 2.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 103 ISHYWNYNDLSHKSSTVRGVSYDRDEQ 23 IS Y +Y D+ H S T + +SY D++ Sbjct: 17 ISTYLDYKDIVHLSETCKSLSYVFDDK 43 >SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 338 LFAGPSSCSAARCGR 294 L PSSCS +RCGR Sbjct: 133 LITDPSSCSFSRCGR 147 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.8 bits (54), Expect = 3.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 216 CGQTASELGDCVNVFAVESRSGFTIKTAASCG 311 CG+ ASE+ D FAV R F ++T + G Sbjct: 751 CGKDASEIQDVKEAFAVNRR--FWVQTLSDIG 780 >SPBC3B9.08c |||Mago-nashi homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 147 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/28 (32%), Positives = 20/28 (71%) Frame = -3 Query: 378 GLKSNGDILRDMRLVCWSIVMLSRTMRP 295 GLK +++D++ +C+S++ L+ +RP Sbjct: 117 GLKVFYYLIQDLKALCFSLISLNFKLRP 144 >SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 99 LILARSAIIFTQLL*DKMCWISV 167 L++ R A++F QLL K W SV Sbjct: 5 LLVPRRALLFGQLLPPKYSWYSV 27 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 408 PPPEADPSGPGLKSNGDILRDMRLVCWSI 322 P + S PG+ + GD R LV W I Sbjct: 2050 PTKSYETSVPGIYAAGDCRRGQSLVVWGI 2078 >SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 24.6 bits (51), Expect = 9.0 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -2 Query: 262 AKTFTQSPSSLAVWPQH*LPLASCTCSSTKVGTEIQHILSYNNCVKI--IALRAN 104 AK + ++ ++ PQ LPL + S + H++ Y N I + LR+N Sbjct: 187 AKNYEENREPMSPSPQEALPLMPSSPPSQDYQNDQNHLILYTNSESIPKLNLRSN 241 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,129,712 Number of Sequences: 5004 Number of extensions: 41499 Number of successful extensions: 99 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -