BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F11f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 5.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 5.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.7 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 7.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 7.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 7.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 7.7 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 7.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 7.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.7 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 113 KRYYFHTIVIGQNVLDFRA 169 K+YY H GQ L++R+ Sbjct: 180 KQYYLHQFATGQPDLNYRS 198 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = -2 Query: 202 LASCTCSSTKVGTEIQHILSYNN 134 L + C+ST + +H+L++N+ Sbjct: 629 LNNSMCTSTTTSPDKEHVLAHND 651 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 450 AAP*GTYCWEALEGPPPEADPSGPGLKSNGDIL 352 A P Y W A G P SGP + G +L Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVL 295 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.4 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 Query: 450 AAP*GTYCWEALEGPPPEADPSGPGLKSNGDIL 352 A P Y W A G P SGP + G +L Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVL 295 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -1 Query: 452 MLRLEAHIVGKHWKVHHPKPILLDQDL 372 + RLE H+ K W +P + Q L Sbjct: 236 LARLERHLERKAWVASFGRPKMTPQSL 262 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 455 QCPPEQQSFGYANLDASY 508 +CP + SFGY D Y Sbjct: 143 RCPLQFGSFGYTKRDVIY 160 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 480 LDMPIWMLHIY 512 +D P+W HIY Sbjct: 631 IDSPVWGRHIY 641 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 127 KIIALRANISHYWNYNDLSHK 65 KII+ +N +Y NYN+ ++K Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 Query: 480 LDMPIWMLHIY 512 +D P+W HIY Sbjct: 631 IDSPVWGRHIY 641 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,490 Number of Sequences: 438 Number of extensions: 3108 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -