BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS307F11f
(521 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.5
AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.4
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.4
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.4
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 5.8
DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 5.8
EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 7.7
DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 7.7
DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 7.7
DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 7.7
DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 7.7
DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 7.7
DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 7.7
AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 7.7
>AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase
protein.
Length = 580
Score = 22.6 bits (46), Expect = 2.5
Identities = 8/19 (42%), Positives = 12/19 (63%)
Frame = +2
Query: 113 KRYYFHTIVIGQNVLDFRA 169
K+YY H GQ L++R+
Sbjct: 180 KQYYLHQFATGQPDLNYRS 198
>AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein.
Length = 735
Score = 21.8 bits (44), Expect = 4.4
Identities = 7/23 (30%), Positives = 15/23 (65%)
Frame = -2
Query: 202 LASCTCSSTKVGTEIQHILSYNN 134
L + C+ST + +H+L++N+
Sbjct: 629 LNNSMCTSTTTSPDKEHVLAHND 651
>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
AbsCAM-Ig7B protein.
Length = 1923
Score = 21.8 bits (44), Expect = 4.4
Identities = 12/33 (36%), Positives = 14/33 (42%)
Frame = -3
Query: 450 AAP*GTYCWEALEGPPPEADPSGPGLKSNGDIL 352
A P Y W A G P SGP + G +L
Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVL 295
>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
AbsCAM-Ig7A protein.
Length = 1919
Score = 21.8 bits (44), Expect = 4.4
Identities = 12/33 (36%), Positives = 14/33 (42%)
Frame = -3
Query: 450 AAP*GTYCWEALEGPPPEADPSGPGLKSNGDIL 352
A P Y W A G P SGP + G +L
Sbjct: 263 ACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVL 295
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 21.4 bits (43), Expect = 5.8
Identities = 9/27 (33%), Positives = 13/27 (48%)
Frame = -1
Query: 452 MLRLEAHIVGKHWKVHHPKPILLDQDL 372
+ RLE H+ K W +P + Q L
Sbjct: 236 LARLERHLERKAWVASFGRPKMTPQSL 262
>DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel
protein.
Length = 463
Score = 21.4 bits (43), Expect = 5.8
Identities = 8/18 (44%), Positives = 10/18 (55%)
Frame = +2
Query: 455 QCPPEQQSFGYANLDASY 508
+CP + SFGY D Y
Sbjct: 143 RCPLQFGSFGYTKRDVIY 160
>EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein.
Length = 683
Score = 21.0 bits (42), Expect = 7.7
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = +3
Query: 480 LDMPIWMLHIY 512
+D P+W HIY
Sbjct: 631 IDSPVWGRHIY 641
>DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex
determiner protein.
Length = 174
Score = 21.0 bits (42), Expect = 7.7
Identities = 9/21 (42%), Positives = 15/21 (71%)
Frame = -2
Query: 127 KIIALRANISHYWNYNDLSHK 65
KII+ +N +Y NYN+ ++K
Sbjct: 80 KIISSLSNNYNYSNYNNNNYK 100
>AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein.
Length = 683
Score = 21.0 bits (42), Expect = 7.7
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = +3
Query: 480 LDMPIWMLHIY 512
+D P+W HIY
Sbjct: 631 IDSPVWGRHIY 641
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,490
Number of Sequences: 438
Number of extensions: 3108
Number of successful extensions: 15
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -