BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F10f (489 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.16c |||transcription factor |Schizosaccharomyces pombe|... 27 1.1 SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 3.5 SPAC688.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 4.6 SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr... 25 6.1 SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large... 25 8.1 SPAC3C7.05c |mug191||alpha-1,6-mannanase |Schizosaccharomyces po... 25 8.1 >SPBC1773.16c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 595 Score = 27.5 bits (58), Expect = 1.1 Identities = 14/60 (23%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Frame = +2 Query: 68 KEN*KVTIVYLPFTTM---NMQQREEKQLEATIVAILNRVNDLKTAIQALINKLETEYET 238 +EN + I+Y P +T N ++ E +L+ + A+ R ++ + ++AL + L ++ ++ Sbjct: 49 QENERYPILYTPLSTSDHDNDEENEINELKNAVKALDKRFDNFELKLEALFSLLRSQQDS 108 >SPAC23H4.16c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 25.8 bits (54), Expect = 3.5 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +2 Query: 272 ILSGHLTGLSKILQAEQAASLRSRIVLPLQLSCERDETLAHLTEGR-VPACTHDL 433 ILSG ++ L K+ E AAS+ S+ V+ E +E A L + VP+ ++ L Sbjct: 92 ILSGRISELLKVSPFELAASVTSQDVVEADSLVEENELQAWLEKQELVPSSSNFL 146 >SPAC688.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1038 Score = 25.4 bits (53), Expect = 4.6 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 179 NDLKTAIQALINKLETEYETINWP-TFLDNYAILSGHLTGLSKILQAEQAASL 334 +D++ + + E E ++P TF+ A S H T +K++ A+++A L Sbjct: 79 DDIENEASSFSEQSENENYDFSYPGTFVYRKAASSSHETLATKVVSADESARL 131 >SPAC16E8.09 |scd1|ral1|RhoGEF Scd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 872 Score = 25.0 bits (52), Expect = 6.1 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 107 TTMNMQQREE-KQLEATIVAILNRVNDLKTAIQALINKLETEYETINWPTFLDNY 268 T Q EE KQ A +V + N+VN+ + + +E E I+W + Y Sbjct: 375 TPSGYQYEEELKQGMACVVRVANQVNETRRIHENRNAIIELEQRVIDWKGYSLQY 429 >SPBC651.08c |rpc1||DNA-directed RNA polymerase III complex large subunit Rpc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1405 Score = 24.6 bits (51), Expect = 8.1 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 293 GLSKILQAEQAASLRSRIVLPLQLSCERDETLAHLTEGRV 412 G+ +I + AA S ++ QL +RDE A + +GR+ Sbjct: 1079 GVPRIKEIINAAKTISTPIITGQLINDRDERSARVVKGRI 1118 >SPAC3C7.05c |mug191||alpha-1,6-mannanase |Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 24.6 bits (51), Expect = 8.1 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -2 Query: 338 TAMKLLVRLGEFY*GQSGDQIKSRNYLEKLA 246 TAM LL+ LGEF G D K YLE +A Sbjct: 243 TAMSLLMGLGEFTKGLQ-DIEKLPTYLEDMA 272 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,761,159 Number of Sequences: 5004 Number of extensions: 30658 Number of successful extensions: 76 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -