BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F10f (489 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 26 0.80 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 24 2.4 Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 23 5.6 Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. 23 5.6 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 23 5.6 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 25.8 bits (54), Expect = 0.80 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 461 QVWYEVNLELNH-ECKLELCLLSNEPVFHHVR 369 ++ YE +E+++ EC L+ CL + P+ H R Sbjct: 284 ELTYEAAMEMDYLECVLKECLRKHPPISVHFR 315 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 24.2 bits (50), Expect = 2.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 380 ETLAHLTEGRVPACTH 427 ETLA L +GR P TH Sbjct: 53 ETLAFLCQGRYPMLTH 68 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 73 ELKSYNCVPTIYNNEYAAARRKATRSY 153 +L +C+PT+ +N +A +A + Y Sbjct: 45 KLNPQHCIPTLVDNGFALWESRAIQIY 71 >Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. Length = 140 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 73 ELKSYNCVPTIYNNEYAAARRKATRSY 153 +L +C+PT+ +N +A +A + Y Sbjct: 45 KLNPQHCIPTLVDNGFALWESRAIQIY 71 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 23.0 bits (47), Expect = 5.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +1 Query: 73 ELKSYNCVPTIYNNEYAAARRKATRSY 153 +L +C+PT+ +N +A +A + Y Sbjct: 45 KLNPQHCIPTLVDNGFALWESRAIQIY 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 438,786 Number of Sequences: 2352 Number of extensions: 7033 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -