BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F10f (489 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF521562-1|AAM76709.1| 268|Homo sapiens mediator of RNA polymer... 133 4e-31 BC010543-1|AAH10543.1| 212|Homo sapiens MED8 protein protein. 45 2e-04 BC010019-1|AAH10019.3| 179|Homo sapiens mediator of RNA polymer... 45 2e-04 AL139289-6|CAI23382.1| 179|Homo sapiens mediator of RNA polymer... 45 2e-04 AL139289-5|CAI23381.1| 212|Homo sapiens mediator of RNA polymer... 45 2e-04 D87071-1|BAA13240.1| 2035|Homo sapiens KIAA0233 protein. 29 6.5 BC150271-1|AAI50272.1| 2035|Homo sapiens family with sequence si... 29 6.5 AB161230-1|BAF03565.1| 2090|Homo sapiens Mib protein. 29 6.5 >AF521562-1|AAM76709.1| 268|Homo sapiens mediator of RNA polymerase II transcription subunit MED8 protein. Length = 268 Score = 133 bits (321), Expect = 4e-31 Identities = 60/119 (50%), Positives = 90/119 (75%) Frame = +2 Query: 125 QREEKQLEATIVAILNRVNDLKTAIQALINKLETEYETINWPTFLDNYAILSGHLTGLSK 304 QREEKQLEA++ A+L++V DLK ++ + I KLE EY + WP+ LD++A+LSG L L+K Sbjct: 2 QREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNK 61 Query: 305 ILQAEQAASLRSRIVLPLQLSCERDETLAHLTEGRVPACTHDLVPDLLRTKPEPQAEQR 481 +L+ E+ R+++++PL LS +RDE L TEGRVP +H++VPD LRTKP+P+ E++ Sbjct: 62 VLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQ 120 >BC010543-1|AAH10543.1| 212|Homo sapiens MED8 protein protein. Length = 212 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = +2 Query: 398 TEGRVPACTHDLVPDLLRTKPEPQAEQR 481 TEGRVP +H++VPD LRTKP+P+ E++ Sbjct: 4 TEGRVPVFSHEVVPDHLRTKPDPEVEEQ 31 >BC010019-1|AAH10019.3| 179|Homo sapiens mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae) protein. Length = 179 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = +2 Query: 398 TEGRVPACTHDLVPDLLRTKPEPQAEQR 481 TEGRVP +H++VPD LRTKP+P+ E++ Sbjct: 4 TEGRVPVFSHEVVPDHLRTKPDPEVEEQ 31 >AL139289-6|CAI23382.1| 179|Homo sapiens mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae) protein. Length = 179 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = +2 Query: 398 TEGRVPACTHDLVPDLLRTKPEPQAEQR 481 TEGRVP +H++VPD LRTKP+P+ E++ Sbjct: 4 TEGRVPVFSHEVVPDHLRTKPDPEVEEQ 31 >AL139289-5|CAI23381.1| 212|Homo sapiens mediator of RNA polymerase II transcription, subunit 8 homolog (S. cerevisiae) protein. Length = 212 Score = 44.8 bits (101), Expect = 2e-04 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = +2 Query: 398 TEGRVPACTHDLVPDLLRTKPEPQAEQR 481 TEGRVP +H++VPD LRTKP+P+ E++ Sbjct: 4 TEGRVPVFSHEVVPDHLRTKPDPEVEEQ 31 >D87071-1|BAA13240.1| 2035|Homo sapiens KIAA0233 protein. Length = 2035 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 286 VTR*NRVII*KSWPIYCLVFRF*FIYQCLYC 194 +TR +R I + WP YCL +YQ L C Sbjct: 540 LTRRHRQAIARLWPNYCLFLALFLLYQYLLC 570 >BC150271-1|AAI50272.1| 2035|Homo sapiens family with sequence similarity 38, member A protein. Length = 2035 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 286 VTR*NRVII*KSWPIYCLVFRF*FIYQCLYC 194 +TR +R I + WP YCL +YQ L C Sbjct: 540 LTRRHRQAIARLWPNYCLFLALFLLYQYLLC 570 >AB161230-1|BAF03565.1| 2090|Homo sapiens Mib protein. Length = 2090 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 286 VTR*NRVII*KSWPIYCLVFRF*FIYQCLYC 194 +TR +R I + WP YCL +YQ L C Sbjct: 595 LTRRHRQAIARLWPNYCLFLALFLLYQYLLC 625 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,941,725 Number of Sequences: 237096 Number of extensions: 1009401 Number of successful extensions: 1861 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1861 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4366354454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -