BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F09f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 79 3e-15 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) 27 7.1 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 78.6 bits (185), Expect = 3e-15 Identities = 36/59 (61%), Positives = 48/59 (81%) Frame = +2 Query: 299 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLXG 475 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I + +L +GFVFLFT+GGL G Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTG 59 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 278 HHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL 427 HH+ T+ I + T+I PT I + + +H T IN +P ++ Sbjct: 14 HHLHTIIIHLHPTVIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHPTVI 63 >SB_8329| Best HMM Match : FTR1 (HMM E-Value=0.87) Length = 371 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 124 WTS*SLYFNFTRIWYNFSYYFTRKRKKRNFWLFRNNLCYTSNWVI 258 W++ LY + +W N Y + N L+ N+ C SN VI Sbjct: 326 WSNAVLYTYHSCLWSNAVLYTNHSCLRSNAVLYTNHSCLRSNAVI 370 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,720,014 Number of Sequences: 59808 Number of extensions: 176816 Number of successful extensions: 268 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -