BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 24 2.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.6 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.2 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 2.7 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +1 Query: 121 FWTS*SLYFNFTRIWYNFSYYFTRKRKKRNFWLFRNN 231 F+ S + F R+ NF+Y++T+ ++ ++F N+ Sbjct: 649 FYDSLPFGYPFDRV-INFNYFYTKNMYFKDVFIFHND 684 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +2 Query: 326 TSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLXGEF 481 TS+ I++ + I F + ++ + + + LGF +LF G GEF Sbjct: 2853 TSSWILMNPSSLISSFVSITSVAAKALFFVAKLTMSLGFTYLFAALGQGGEF 2904 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 170 LYQILVKLKYKLQDVQKIKINVD 102 L +IL +L+ +LQ+VQK+ N D Sbjct: 1102 LNEILRELEARLQEVQKLLDNAD 1124 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.2 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +2 Query: 326 TSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLXGEF 481 TSA I+ I FR + T G + + + F +LF + GEF Sbjct: 2843 TSAFIVTNPNQLINTFRSITTTLGRALFVTATVAITITFAYLFGALKMGGEF 2894 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 378,587 Number of Sequences: 2352 Number of extensions: 6342 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -