BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307F04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0925 - 12440917-12441560,12441675-12441810 31 0.56 01_01_0134 - 1224084-1224269,1224578-1224662,1224763-1225050,122... 31 0.56 01_01_0017 + 133311-133615,133698-133824,133912-134253 29 2.3 06_01_0900 + 6926600-6927202 28 4.0 07_03_0064 + 12995669-12995904,12996299-12996533,12998223-129983... 28 5.2 05_01_0188 - 1357074-1357098,1357811-1357941,1358572-1358667,135... 28 5.2 11_02_0005 - 7264736-7264753,7265086-7265188,7265487-7265539,726... 27 6.9 05_06_0180 + 26173452-26173692,26174456-26174698,26174796-261750... 27 9.1 02_05_0482 + 29382696-29383251,29383376-29383692 27 9.1 01_05_0433 - 22094784-22095659 27 9.1 >03_02_0925 - 12440917-12441560,12441675-12441810 Length = 259 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -2 Query: 211 NVFTKGYFVTLLIFIYIIYYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCT 44 N++++GY + ++ RG+ S C CA +HRR P A T T T Sbjct: 53 NLYSQGYGTSTAALSTALFNRGL---SCGSCYELRCAGDHRRSCLPGGATVTVTAT 105 >01_01_0134 - 1224084-1224269,1224578-1224662,1224763-1225050, 1225114-1225334,1225511-1225642,1226218-1226494, 1226722-1226770,1226993-1227088,1227779-1227911, 1228241-1228391,1228484-1228674,1229167-1229382 Length = 674 Score = 31.1 bits (67), Expect = 0.56 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 403 GSTWRPKISKRSTTKHKNGLYRFF 332 GS + PK+ ++STTKH+ G +R F Sbjct: 338 GSEFSPKLIQKSTTKHRRGWWRQF 361 >01_01_0017 + 133311-133615,133698-133824,133912-134253 Length = 257 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 133 SASECVGCTCAREHRRDTPPTSAPHTRT 50 S+S C + R+ PP APHT T Sbjct: 6 SSSTASAAACCKSRSRNPPPAPAPHTST 33 >06_01_0900 + 6926600-6927202 Length = 200 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 64 VRRWGACLGGARARTCIRRTRSHSRYILHG 153 VR W + G R +T IRR R R+ HG Sbjct: 76 VREWSELVAGPRWKTFIRRFRRSPRHHHHG 105 >07_03_0064 + 12995669-12995904,12996299-12996533,12998223-12998384, 12999446-12999566,13000095-13001608 Length = 755 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 408 WEGAEAVSKGGARALGINSSADLWAPFNGRRR 503 + A AV+ G+ LG+ ++ADL A + GR R Sbjct: 665 YAAARAVTVAGSPKLGVYAAADLGATWGGRPR 696 >05_01_0188 - 1357074-1357098,1357811-1357941,1358572-1358667, 1358736-1358769,1358867-1358958,1359273-1359332, 1359376-1359435,1360016-1360525,1360645-1360719, 1360809-1361015 Length = 429 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 140 TYSTVINNINKYQQRYKIAFRKNIRSLKCIYFCLAYKKKRIAYLVFYSFSLIINS 304 T TV++ N Y + N+ I F +K KR+AYL Y + +IN+ Sbjct: 35 TTKTVLDPWNPYFPLWPPEIPPNLGLNGAICFIEDWKMKRMAYLASYRSTCVINA 89 >11_02_0005 - 7264736-7264753,7265086-7265188,7265487-7265539, 7265791-7265880,7266093-7266217,7266528-7266753 Length = 204 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 394 RSNLGGKVPKPSARAGRERWG*TPVLIYGRP--LMDAAGLTPL 516 RSN G+VPK + G ERW P +P L +AA L L Sbjct: 69 RSNSEGQVPKKTTSMGFERWWLPPPPEVKKPRSLYNAASLAYL 111 >05_06_0180 + 26173452-26173692,26174456-26174698,26174796-26175009, 26175115-26175194,26175381-26175502,26175950-26176053, 26176457-26176644,26176725-26176924,26177104-26177331 Length = 539 Score = 27.1 bits (57), Expect = 9.1 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -2 Query: 490 LKGAHRSALEFIPSARAPPLLTASAPS---HLGSTWRPKISKRSTTKHK 353 ++G HR LE + ++ P TAS PS LGS P SK+S+ K K Sbjct: 463 IQGYHRELLEQMIASGWKPPPTASEPSRKLRLGSRKAPP-SKKSSMKRK 510 >02_05_0482 + 29382696-29383251,29383376-29383692 Length = 290 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 391 ARSNLGGKVPKPSARAGRERWG 456 +R LG K P P R G+ER G Sbjct: 39 SRKRLGAKPPSPQRRGGQEREG 60 >01_05_0433 - 22094784-22095659 Length = 291 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 442 APPLLTASAPSHLGSTWRPKISKRSTTKHK 353 APP++ A+APS + S + S STT K Sbjct: 250 APPIVVAAAPSPVRSVVKASSSSSSTTDAK 279 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,907,141 Number of Sequences: 37544 Number of extensions: 288493 Number of successful extensions: 973 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 949 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -