BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E12f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23936| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.082 SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) 33 0.14 SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) 31 0.76 SB_34294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) 29 1.8 SB_13194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_30758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_22858| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_46762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_51704| Best HMM Match : F-box (HMM E-Value=3.3e-05) 28 4.1 SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 28 5.4 SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_57670| Best HMM Match : LON (HMM E-Value=6.8e-07) 28 5.4 SB_58417| Best HMM Match : zf-CCCH (HMM E-Value=0.96) 27 7.1 SB_11938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_17349| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_19440| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_10315| Best HMM Match : Pentaxin (HMM E-Value=5e-12) 27 9.4 >SB_23936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.9 bits (74), Expect = 0.082 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 63 PRTTVTRNCCCWNRNYKQSALRMNSFKVQYVIALCIVAAVG 185 P+T CCCW+R YK + + Q IA ++ G Sbjct: 6 PKTRTKGQCCCWSRRYKDIKAKQIQLRYQKEIANTVIRLGG 46 >SB_41539| Best HMM Match : PUD (HMM E-Value=0.42) Length = 1582 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ ++ PY GPY PYV Sbjct: 3 GPYVAM-EGPYVAMEGPYVAMEGPYVAMGGPYVAMEGPYV 41 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ ++ PY GPY PYV Sbjct: 17 GPYVAM-EGPYVAMGGPYVAMEGPYVAMGGPYVAMGGPYV 55 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ ++ PY GPY PYV Sbjct: 204 GPYVAM-EGPYVAMGGPYVAMEGPYVAMEGPYVAMGGPYV 242 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVG 356 G Y+ EG Y+ + PY+ ++ PY GPY PY G Sbjct: 225 GPYVAM-EGPYVAMGGPYVAMEGPYVAMEGPYVAMEGPYGG 264 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 255 EGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 EG Y+ + PY+ ++ PY GPY PYV Sbjct: 305 EGPYVAMEGPYVAMEGPYVAMGGPYVAMEGPYV 337 Score = 32.3 bits (70), Expect = 0.25 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ ++ PY GPY PYV Sbjct: 313 GPYVAM-EGPYVAMGGPYVAMEGPYVAMGGPYVAMGGPYV 351 Score = 31.9 bits (69), Expect = 0.33 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 255 EGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 EG Y+ + PY+ ++ PY GPY PYV Sbjct: 2 EGPYVAMEGPYVAMEGPYVAMEGPYVAMGGPYV 34 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ + PY GPY PYV Sbjct: 197 GPYVAM-EGPYVAMEGPYVAMGGPYVAMEGPYVAMEGPYV 235 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ + PY GPY PYV Sbjct: 218 GPYVAM-EGPYVAMEGPYVAMGGPYVAMEGPYVAMEGPYV 256 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ + PY GPY PYV Sbjct: 10 GPYVAM-EGPYVAMEGPYVAMGGPYVAMEGPYVAMGGPYV 48 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ + PY GPY PYV Sbjct: 31 GPYVAM-EGPYVAMGGPYVAMGGPYVAMGGPYVAMEGPYV 69 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ + PY GPY PYV Sbjct: 306 GPYVAM-EGPYVAMEGPYVAMGGPYVAMEGPYVAMGGPYV 344 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ G Y+ + PY+ + PY GPY PYV Sbjct: 38 GPYVAMG-GPYVAMGGPYVAMGGPYVAMEGPYVAMEGPYV 76 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPY 329 G Y+ EG Y+ + PY+ ++ PY GPY Sbjct: 264 GPYVAM-EGPYVAMGGPYVAMEGPYVAMGGPY 294 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG Y+ + PY+ ++ P GPY PYV Sbjct: 278 GPYVAM-EGPYVAMGGPYVAMEGPNVAMEGPYVAMEGPYV 316 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ EG + + PY+ ++ PY GPY PYV Sbjct: 292 GPYVAM-EGPNVAMEGPYVAMEGPYVAMEGPYVAMGGPYV 330 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 234 GKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDY 341 G Y+ G Y+ + PY+ ++ PY GPY Y Sbjct: 232 GPYVAMG-GPYVAMEGPYVAMEGPYVAMEGPYGGPY 266 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 258 GKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G Y+ + PY+ + PY GPY PYV Sbjct: 264 GPYVAMEGPYVAMGGPYVAMEGPYVAMGGPYV 295 >SB_26836| Best HMM Match : BTB (HMM E-Value=1.1e-37) Length = 521 Score = 30.7 bits (66), Expect = 0.76 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 201 GKWHPYHYGDSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDY 341 G+ Y G S +Y+P EG Y +P PY + GGFG Y Sbjct: 436 GQPDSYRAG-SKEYVPQPEG-YSAVPGPYQSYGRGWQGGFGQVQPSY 480 >SB_34294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 223 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/75 (30%), Positives = 28/75 (37%), Gaps = 1/75 (1%) Frame = +3 Query: 204 KWHPYHYGDSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYR 383 K H Y D Y PY + Y PY H PY+ AT Y+ Sbjct: 41 KNHATPYKDHATPYKDHATPYKDHATPYKDLATSYKDHVTPYKHLATPYIDYAT---PYK 97 Query: 384 LILTPPKDIPF-YKD 425 + TP KD+ YKD Sbjct: 98 DLATPYKDLATPYKD 112 >SB_8332| Best HMM Match : PDZ (HMM E-Value=1.3e-17) Length = 1038 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +3 Query: 264 YIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYR 383 Y H+ PY H+ Y + YAH Y Y YR Sbjct: 761 YAHVYRPYAHVYRTYARVYRTYAHLYRTYAHGTEHMHVYR 800 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/41 (29%), Positives = 16/41 (39%) Frame = +3 Query: 228 DSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPY 350 DS + Y H+ Y H+ Y + YAH Y Y Sbjct: 721 DSSRTYSLQYRPYAHVYRTYAHVYRTYARVYRTYAHVYRTY 761 >SB_13194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 264 YIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLILTPPKDIPF-YKDGYYKN 440 Y+ + PY+ + PY G PY PYV + TV Y + P D+ Y D K Sbjct: 216 YVDVTVPYVDVTVPYVDGTVPYVDVTVPYV-DVTV--PYVDVTVPYVDVTVPYIDVTLKP 272 Query: 441 NGIKI 455 GI + Sbjct: 273 TGIPL 277 >SB_30758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 327 YAHDYEPYVGEATVQDQYRLILTPPKDIPFYKDGYYKNN 443 Y + EP +GEAT++ R + PP + P Y Y N Sbjct: 333 YLNRQEPGLGEATLRHLLRPRVDPPHEHPAYDYDYIHEN 371 >SB_22858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1404 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/69 (21%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Frame = +3 Query: 288 IHIDNPYDGGFGPY-----AHDYEPYVGEATVQDQYRLILTPPKDIPFYKDGYYKNNGIK 452 I+ +NP +G Y + +Y P++ + Q + PP+ P + + + Sbjct: 276 IYDENPSPEAYGEYFLMNPSKEYAPFIHTMREKIQLSKVSVPPEGCPSFTEDSLLRHAQF 335 Query: 453 IIKQKHNYD 479 +++Q NYD Sbjct: 336 LVEQIENYD 344 >SB_46762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 219 HYGDSGKYIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 ++ + YI T+ YI+I PYI+I+ PY Y PY+ Sbjct: 53 YFDTNWPYINTNR-PYININRPYININRPYINTSRAYFDTNWPYI 96 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 240 YIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 Y+ T+ YI+ PYI+ + PY PY + PY+ Sbjct: 11 YVNTNR-PYINTNRPYINTNRPYINTNRPYININRPYI 47 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 240 YIPTDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 YI T+ YI+I PYI+ Y PY + PY+ Sbjct: 32 YINTNR-PYININRPYINTSRAYFDTNWPYINTNRPYI 68 >SB_51704| Best HMM Match : F-box (HMM E-Value=3.3e-05) Length = 337 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 360 PRQHRVHSRVHMVQSHHRKGYQCECKGWE 274 PR +V +V MV H R Y C GW+ Sbjct: 236 PRHSKVIYKVGMVMRHRRYHYGCVIWGWD 264 >SB_15415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +3 Query: 249 TDEGKYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLIL--TPPKDIPF 416 T+ KY H N + I N G Y +G+ TV + R+ + +PP+DI F Sbjct: 750 TNRNKYTHFNNGSLKIMNLEKEDTGKYMCTASNTLGKQTVMRRLRVQIPPSPPQDIAF 807 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +3 Query: 264 YIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLILTPPKDIP 413 Y +P+PY + +PY PY PY V Y+ + P K +P Sbjct: 672 YKQVPHPYKQVPHPYKQVPAPYKQVPLPY---KQVPPPYKQVPHPYKQVP 718 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +3 Query: 264 YIHIPNPYIHIDNPYDGGFGPYAHDYEPYVGEATVQDQYRLILTPPKDIP 413 Y +P+PY + PY PY PY V Y+ + P K +P Sbjct: 735 YKQVPHPYKQVPPPYKQVPPPYKQVPHPY---KQVPAPYKQVPAPYKQVP 781 >SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1283 Score = 27.9 bits (59), Expect = 5.4 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 3/90 (3%) Frame = +3 Query: 183 GVPVEDGKWHPYHYGDSGKYIPTDEGKYIH---IPNPYIHIDNPYDGGFGPYAHDYEPYV 353 G P DG PY D +I T G+ +H +P + NP GPY HD P++ Sbjct: 840 GPPRRDG---PYR--DEPGFIDTPMGRGMHQRDMPPEWHPAGNPRRVDEGPYMHDGPPHI 894 Query: 354 GEATVQDQYRLILTPPKDIPFYKDGYYKNN 443 +++ I P +IP G ++ + Sbjct: 895 ------NRHPFIEQGPVEIPISHSGPWQGD 918 >SB_57670| Best HMM Match : LON (HMM E-Value=6.8e-07) Length = 224 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 116 KCIKDEFVQGAVCDCAMHRSRGGCTC*GWKMASLPLR 226 KCI D CD MH + G W +A+LPL+ Sbjct: 147 KCITDAIGPMPNCDPNMHVQQDGPEWVWWSLAALPLQ 183 >SB_58417| Best HMM Match : zf-CCCH (HMM E-Value=0.96) Length = 210 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 54 LPVPRTTVTRNCCCWNR 104 LP PR+ T NC WNR Sbjct: 137 LPQPRSRSTTNCISWNR 153 >SB_11938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 264 YIHIPNPYIHIDNPYDGGFGPYAHDYEPYV 353 Y+ + PY+ + PY G PY PYV Sbjct: 216 YVDVTVPYVDVTVPYVDGTVPYVDVTVPYV 245 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 399 PKDIPFYKDGYYKNNGIKIIKQKHN 473 P D+ F YY NNG K KQ+H+ Sbjct: 139 PGDLVFITATYYVNNGKKWKKQRHD 163 >SB_17349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 16 NEFPHSDLASCSAYQCP 66 NE P SD A AYQCP Sbjct: 25 NEIPDSDPAPAPAYQCP 41 >SB_19440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 261 KYIHIPNPYIHIDNPYDGGFGPYAHDYEPYVG 356 KY+ + + Y+ + + Y G + Y Y YVG Sbjct: 13 KYVRVYHEYVRVYHEYVGVYPKYVGVYHEYVG 44 >SB_10315| Best HMM Match : Pentaxin (HMM E-Value=5e-12) Length = 697 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 183 GVPVEDGKWHPYHYG 227 G PV DGKWH HYG Sbjct: 370 GPPVVDGKWH--HYG 382 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,811,095 Number of Sequences: 59808 Number of extensions: 391665 Number of successful extensions: 1253 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1002 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -