BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 25 1.5 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 4.7 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 23 8.2 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 8.2 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 231 NRRNGKDAIFHPQQVHPPRLRCIAQSHTA 145 NRRN +++ + Q VH P+ Q H A Sbjct: 204 NRRNERESTQYQQSVHQPQQSSRDQQHGA 232 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 4.7 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +3 Query: 105 NYKQSALRMNSFKVQYVIALCIVAAVGVPVEDGKWHPYHYG-DSGKYI 245 NY + A +++ VQ IA +P +DG HY + KY+ Sbjct: 936 NYDRGATQVSKQTVQIPIANFDTYEYDMPTKDGDVFKLHYKVQNNKYV 983 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = +3 Query: 354 GEATVQDQYRLILTPPKDIPFYKDGYYKNNGIKIIKQ 464 G +D +RL L + +P+ DG+ + N + +++ Sbjct: 195 GYDAAKDGHRLELVAEQSVPYNYDGWVELNATQAMQR 231 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = +3 Query: 99 NRNYKQSALRMNSFKVQYVIALCIVAAVGVPVEDGKW 209 NR+ L +N+ +V+ +V VP +G W Sbjct: 9 NRSRSAQDLALNTMRVERADVCLMVELHSVPRNNGNW 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,086 Number of Sequences: 2352 Number of extensions: 12434 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -