BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 2.9 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 3.8 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 5.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 6.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 6.6 AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 21 6.6 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 21 6.6 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 6.6 AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esteras... 21 6.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 6.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 6.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 6.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 6.6 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 6.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 6.6 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -1 Query: 263 SNSSLELGTEIFWFDVQNFRCKNS 192 S++ +E + ++WF V+ CK S Sbjct: 389 SDAEIEKLSTVYWFTVEFGLCKES 412 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 3.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRISGAKIVPESYTCLTT 164 L+TP+ + A +SSGL S +S + P TT Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTT 162 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.4 bits (43), Expect = 5.0 Identities = 11/30 (36%), Positives = 12/30 (40%), Gaps = 8/30 (26%) Frame = +2 Query: 290 WLPNYC-----FSPAF---HCQWFQEPFGH 355 W NYC +P HC W FGH Sbjct: 79 WRSNYCDNKQQANPPISTEHCDWLYGIFGH 108 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 114 EATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKP 227 + T +N +SP S GL + SGT+ P L +P Sbjct: 198 DGTSVNFHYLSPQSRGLFHRGWSMSGTMLVPWALMEQP 235 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 114 EATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKP 227 + T +N +SP S GL + SGT+ P L +P Sbjct: 198 DGTSVNFHYLSPQSRGLFHRGWSMSGTMLVPWALMEQP 235 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 114 EATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKP 227 + T +N +SP S GL + SGT+ P L +P Sbjct: 198 DGTSVNFHYLSPQSRGLFHRGWSMSGTMLVPWALMEQP 235 >AJ850292-1|CAH64512.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 114 EATLLNMLNISPFSYGLVVKQVYDSGTIFAPEILDIKP 227 + T +N +SP S GL + SGT+ P L +P Sbjct: 198 DGTSVNFHYLSPQSRGLFHRGWSMSGTMLVPWALMEQP 235 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 85 LSTPSNSNATKSSGLTSPLS 104 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -2 Query: 265 LATPAWNLARRSSGLMSRIS 206 L+TP+ + A +SSGL S +S Sbjct: 129 LSTPSNSNATKSSGLTSPLS 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,785 Number of Sequences: 336 Number of extensions: 2182 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -