BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 2.7 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 6.2 AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. 23 8.2 AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. 23 8.2 AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. 23 8.2 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 2.7 Identities = 15/69 (21%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +3 Query: 102 VGASEATLLNMLNISPFS-YGLVVKQVYDSGT--IFAPEILDIKPEDLRAKFQAGVANVA 272 VG +E+ +++N+ F+ Y + + +Y +G + + +KPED+ +A + Sbjct: 261 VGVTESA--DLINLEKFAQYAVAIAAMYKTGLGKLSEKATVKVKPEDVPLNLRAHDVSTH 318 Query: 273 ALSLAIGYP 299 +++L+ P Sbjct: 319 SMTLSWAPP 327 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 459 RTVPPRQQLQRTLM 418 RT+PP +QLQ L+ Sbjct: 324 RTIPPEEQLQTELL 337 >AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 169 LSRYMILELFLHLKFWTSNQKISVPS 246 L RY++L FL++ F+TS + PS Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPS 27 >AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 169 LSRYMILELFLHLKFWTSNQKISVPS 246 L RY++L FL++ F+TS + PS Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPS 27 >AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 169 LSRYMILELFLHLKFWTSNQKISVPS 246 L RY++L FL++ F+TS + PS Sbjct: 4 LRRYILL--FLNICFYTSGAEAKAPS 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 460,189 Number of Sequences: 2352 Number of extensions: 8549 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -