BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E08f (494 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30343| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) 52 2e-07 SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) 47 1e-05 SB_28028| Best HMM Match : Cofilin_ADF (HMM E-Value=2e-20) 40 0.001 SB_35589| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44895| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_11461| Best HMM Match : NHL (HMM E-Value=0) 31 0.69 SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) 30 0.91 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_44857| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 29 2.8 SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_46360| Best HMM Match : EGF (HMM E-Value=0) 29 2.8 SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_6077| Best HMM Match : EGF (HMM E-Value=0) 29 2.8 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_57558| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_43377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) 28 4.9 SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) 28 4.9 SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_56973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) 27 6.4 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 27 6.4 SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_58754| Best HMM Match : PucR (HMM E-Value=5.5) 27 8.5 SB_18664| Best HMM Match : PucR (HMM E-Value=5.5) 27 8.5 SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) 27 8.5 SB_41815| Best HMM Match : zf-CXXC (HMM E-Value=3.5e-17) 27 8.5 >SB_30343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 53.2 bits (122), Expect = 1e-07 Identities = 27/83 (32%), Positives = 47/83 (56%) Frame = -1 Query: 461 TGECRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVG 282 T E RY + +Y ++ E +++ KL L+ WCPD +K KM+ +++F + K G Sbjct: 60 TDEPRYVALNLDYKNE-----EGAERSKLVLIFWCPDNCGIKNKMVSAATFKEVMKKCPG 114 Query: 281 VQKYIQATDLSEASQEAVEEKLR 213 K ++ D + S EA++EKL+ Sbjct: 115 GAKCLEIQDRFDLSFEALKEKLK 137 >SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) Length = 387 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/62 (35%), Positives = 40/62 (64%) Frame = -1 Query: 398 EASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 219 E + + KL L+ WCPD ++K +M+ +++F +KK G K ++ + SE S EA++E+ Sbjct: 323 EGADRSKLVLIFWCPDNCEIKSRMVSAATFQDVKKKCPGGAKCLEIQERSELSFEALKEE 382 Query: 218 LR 213 L+ Sbjct: 383 LK 384 >SB_14227| Best HMM Match : Cofilin_ADF (HMM E-Value=0.0013) Length = 310 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/58 (37%), Positives = 33/58 (56%) Frame = -1 Query: 419 HQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSE 246 H+ Q A FL C D A +KKKML S+++ LKK G++KY +A+++ E Sbjct: 241 HKTQDHRSALSDLVFFLFDRCSDEAPIKKKMLAGSTWEYLKKKFDGLKKYFEASEICE 298 >SB_28028| Best HMM Match : Cofilin_ADF (HMM E-Value=2e-20) Length = 151 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/90 (25%), Positives = 40/90 (44%) Frame = -1 Query: 476 LQKGGTGECRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALK 297 ++K E RY L+D ++ + E L +SWC D A ++KKM +S+ D ++ Sbjct: 64 VEKLSDREPRYILYDMKFPRK----EEKRIFNNLVFISWCSDKAPIEKKMKLASTQDYVR 119 Query: 296 KSLVGVQKYIQATDLSEASQEAVEEKLRAT 207 K + A D + + + K T Sbjct: 120 KKFSEATTSVNANDFDDLDYDEIAAKAEKT 149 >SB_35589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/86 (26%), Positives = 43/86 (50%) Frame = -1 Query: 476 LQKGGTGECRYGLFDFEYTHQCQGTSEASKKQKLFLMSWCPDTAKVKKKMLYSSSFDALK 297 L+K E RY L+D + + + L + WC D A +KK+M+ +++ + LK Sbjct: 65 LEKLSDSEPRYILYDLNFPRK-----DGRAFHHLVYIFWCSDNAPIKKRMVSAATNELLK 119 Query: 296 KSLVGVQKYIQATDLSEASQEAVEEK 219 V V+K Q D ++ + + + +K Sbjct: 120 TKFV-VKKVFQINDRADLNYDDIADK 144 >SB_44895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 30.7 bits (66), Expect = 0.69 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 358 HHDIRKSFCFLLASDVPWHWCVYSKSNRPYLHSPVP-PFCRS 480 H + + +C+ S V +C +S +RPY HSPV P+C S Sbjct: 130 HSPVDRPYCY---SPVDHPYC-HSPVDRPYCHSPVDRPYCHS 167 Score = 29.5 bits (63), Expect = 1.6 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 361 HDIRKSFCFLLASDVPWHWCVYSKSNRPYLHSPVP-PFCRS 480 H + +C S V +C YS +RPY HSPV P+C S Sbjct: 95 HSWSRPYCH---SPVDRPYC-YSPVDRPYCHSPVDRPYCHS 131 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 358 HHDIRKSFCFLLASDVPWHWCVYSKSNRPYLHSPVP-PFCRS 480 H + + +C+ S V +C +S +RPY HSPV P+C S Sbjct: 103 HSPVDRPYCY---SPVDRPYC-HSPVDRPYCHSPVDRPYCYS 140 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = +1 Query: 397 SDVPWHWCVYSKSNRPYLHSPVP-PFCRS 480 S V +C +S +RPY HSPV P+C S Sbjct: 149 SPVDRPYC-HSPVDRPYCHSPVDRPYCHS 176 >SB_11461| Best HMM Match : NHL (HMM E-Value=0) Length = 819 Score = 30.7 bits (66), Expect = 0.69 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -1 Query: 206 HRQ*TAFTHELA--TKPNPLSDTPALTTRGHDTTSRLVLLQRKTNSINMIDF 57 H + T EL+ T+ NPL TPAL++RG T R+ + + N+ IDF Sbjct: 289 HEKLENLTQELSDTTRLNPL--TPALSSRGQRGTPRIPYRESQQNAEGNIDF 338 >SB_27884| Best HMM Match : Pox_A32 (HMM E-Value=0.61) Length = 1226 Score = 30.3 bits (65), Expect = 0.91 Identities = 18/52 (34%), Positives = 21/52 (40%) Frame = +2 Query: 209 WRGASLRRPPETLPRGRSLGCTSELRQGTFSERRXXXXXXXXXXPWRCPGTT 364 W G + R PP RS+ TS L TF ERR W P T+ Sbjct: 855 WGGTAERPPPRQSAPSRSMAITSLLCGSTF-ERRTTVLSMGVVSDWSIPATS 905 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/59 (33%), Positives = 23/59 (38%) Frame = +2 Query: 206 GWRGASLRRPPETLPRGRSLGCTSELRQGTFSERRXXXXXXXXXXPWRCPGTTTSGRAS 382 G G + R PP R + TS L TF ERR W P T +G AS Sbjct: 648 GGGGTAERLPPRQSAPSRFMAITSLLCGSTF-ERRTTVLSMGVVSDWSVPATRCAGTAS 705 >SB_44857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.1 bits (62), Expect = 2.1 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +3 Query: 189 CCLLAMGGAELLFDGLLRRFREVGRLDVLLNSDKGLFQS---VERARVQHLLLDLGG 350 CC+L M E L + +GR D + + G F + R +HL+ +GG Sbjct: 85 CCILRMSMTEALAGATINAAASLGRADTHGSLEVGKFADMVVINAERWEHLIYQIGG 141 >SB_37259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1690 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 308 DALKKSLVGVQKYIQATDLSEASQEAVEEKLRATHRQ*TAFTHELATK 165 D LKK + +QK +L +AS E EEK + + + F H++A K Sbjct: 403 DGLKKRMEQIQK-----ELQQASSELEEEKKKTENLLSSIFPHDVANK 445 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 282 SSEVHPSDR-PLGSVSGGRRREAPRHPSPINSIYTRARDETEPALRHS 142 S VH S R PL + + R +PR P P S T T P + HS Sbjct: 605 SPRVHHSPRTPLPAYTSPRVHHSPRTPLPAYSPRTTLPANTTPRVHHS 652 >SB_8814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 185 THELATKPNPLSDTPALTTRGHDTTSRLVLLQRKT-NSINMIDFTGGRTSCESARVGTTA 9 THE L DT T HDTT L T N + D TG T T Sbjct: 515 THETTRHDTHLHDTTENDTHPHDTTGNDTYLHDTTENDTHPHDTTGNDTQLHDTTGNKTR 574 Query: 8 P 6 P Sbjct: 575 P 575 >SB_46360| Best HMM Match : EGF (HMM E-Value=0) Length = 352 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 350 CPGTTTSGRASVS-C*PPTCPGTGACIQSQTGHICI 454 CP T VS C C G+C+ +Q+G+ C+ Sbjct: 189 CPTGVTGRHCDVSICDSKPCRNNGSCVLTQSGYQCL 224 >SB_36970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 285 RSSEVHPSDRPLGSVSGGRRREAPRHP 205 + S++HP D P G RRE RHP Sbjct: 32 KGSKLHPKDLPTCLPMGPHRREFERHP 58 >SB_6077| Best HMM Match : EGF (HMM E-Value=0) Length = 1165 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +2 Query: 350 CPGTTTSGRASVS-C*PPTCPGTGACIQSQTGHICI 454 CP T VS C C G+C+ +Q+G+ C+ Sbjct: 1002 CPTGVTGRHCDVSICDSKPCRNNGSCVLTQSGYQCL 1037 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = -3 Query: 273 VHPSDRPLGSVSGGRRREAPRHPSPI----NSIYTRARDETEPALR-HSC 139 + PSD P G A +HP P+ NS ARD+ P + H C Sbjct: 1425 ITPSDCPAGFYCPNETEWASQHPCPVGTFGNSTKLAARDQCTPCTKGHYC 1474 >SB_57558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = -3 Query: 309 RRSEKVPCRSSEVHPSDRPLGSVSGGRRREAPRHPSPINSIYTRARDE 166 RRS + PCR S +D LG R R SP S T E Sbjct: 238 RRSSEAPCRQSRRSSNDARLGQFVEKRNFHGNRFVSPKKSKKTEVNRE 285 >SB_43377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +3 Query: 183 CKCCLLAMGGAELLFDGLLRRFREVGRLDVLLNSDKGLFQS 305 C CLL G + L DGL RR G ++VLL D G +S Sbjct: 348 CIACLLFGGSRKRLPDGLTRR----GDINVLLLGDPGTAKS 384 >SB_22851| Best HMM Match : Sad1_UNC (HMM E-Value=0) Length = 1705 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/67 (26%), Positives = 34/67 (50%) Frame = -1 Query: 353 DTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLRATHRQ*TAFTHEL 174 +T +V +K+ + +L +S+V +TD++E+S E K+ H+ T+ Sbjct: 1139 ETKEVDEKVTNAQGELSLSESIVTSS----STDIAESSAEMSSSKVEPAHQDVTSQVGNP 1194 Query: 173 ATKPNPL 153 T P+PL Sbjct: 1195 PTPPSPL 1201 >SB_25705| Best HMM Match : PH (HMM E-Value=2e-17) Length = 409 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 239 QEAVEEKLRATHRQ*TAFTHEL--ATKPNPLSDTPALTTRGH 120 +E K+ AT+ AFTH+L KP +SD P + +G+ Sbjct: 22 EETPPIKIEATNHHAKAFTHDLENLAKPLKVSDVPNVFLQGY 63 >SB_14691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 273 VHPSDRPLGSVSGGRRREAPRHPSPINSIYTR 178 +HP D P S RRR PR P +S+ R Sbjct: 200 IHPKDLPEFSKGNFRRRRKPRRPKCSHSLMFR 231 >SB_56973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 347 RCPGTTTSG-RASVSC*PPTCPGTGAC 424 +CP T + G R V C P CP T C Sbjct: 484 QCPKTLSCGHRCGVECHPGACPDTLVC 510 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = -3 Query: 357 PGHRQGQEEDVVL*LVRRSEKVPCRSSEVHPSDRPLGSVSG-GRRREAPRHPSPINSIYT 181 P Q EED V+R++ P R + + P+ S S G + + P+P ++ T Sbjct: 875 PAQHQDNEEDEPENKVKRNKGKPARLQDHEEDEEPVASTSATGITKTPGKGPNPKSARST 934 Query: 180 RA 175 R+ Sbjct: 935 RS 936 >SB_35522| Best HMM Match : AT_hook (HMM E-Value=7.3) Length = 250 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 222 EAPRHPSPINSIYTRARDETEPALRHSCPDDTRPRHH*PLS 100 +AP HP P+ +Y + EP H+ P ++R RH LS Sbjct: 73 KAPLHPRPLQHLYEHS---AEPLPEHT-PVESRQRHDRTLS 109 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 27.5 bits (58), Expect = 6.4 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 1/81 (1%) Frame = -1 Query: 266 QATDLSEASQEAVEEKLRATHRQ*TAF-THELATKPNPLSDTPALTTRGHDTTSRLVLLQ 90 QA L E +Q+ +EE RAT R AF ++ T SD + + Q Sbjct: 339 QAMALVEEAQQHIEENKRATRRDLDAFIDKQIGTLEKMRSDLRGEIESACQKQEKQLTAQ 398 Query: 89 RKTNSINMIDFTGGRTSCESA 27 R+T S+ + R+S E A Sbjct: 399 RETLSMRL---ASARSSLEFA 416 >SB_27034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/64 (29%), Positives = 31/64 (48%) Frame = -1 Query: 338 KKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLRATHRQ*TAFTHELATKPN 159 KKKM L S + Q+Y++ T E S++A E++ H + +L TK + Sbjct: 401 KKKMPLDQEKSKLSLSQIYEQEYLKQTSEPE-SKKAAEDEENPAHAEIKTMMTKLFTKLD 459 Query: 158 PLSD 147 LS+ Sbjct: 460 ALSN 463 >SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = -3 Query: 312 VRRSEKVPCRSSEVHPSDRPLGSVSGGRRREAPRHPSPINSIYT 181 VRRS +P S + P P SVS RR + PSP +S Y+ Sbjct: 286 VRRS--LPSFKSRIRPFQVPRNSVSFVSRRASVLSPSPKHSDYS 327 >SB_58754| Best HMM Match : PucR (HMM E-Value=5.5) Length = 232 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 425 IQSQT-GHICIPRYRPSADPRGG 490 IQ T H+ +PRYRP+AD G Sbjct: 24 IQLNTKAHMTVPRYRPNADAGSG 46 >SB_18664| Best HMM Match : PucR (HMM E-Value=5.5) Length = 232 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +2 Query: 425 IQSQT-GHICIPRYRPSADPRGG 490 IQ T H+ +PRYRP+AD G Sbjct: 24 IQLNTKAHMTVPRYRPNADAGSG 46 >SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) Length = 400 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 371 LMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKY 270 L+SW PD ++K++ SFD K V Y Sbjct: 358 LLSWLPDMERLKEEPKEDKSFDEKIKQAAPVDPY 391 >SB_41815| Best HMM Match : zf-CXXC (HMM E-Value=3.5e-17) Length = 906 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 279 SEVHPSDRPLGSVSGGRRREAPRH-PSP 199 +E P+D G+ S RRR+ P+H PSP Sbjct: 567 NESLPADSTTGTQSTRRRRDPPKHAPSP 594 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,608,193 Number of Sequences: 59808 Number of extensions: 318108 Number of successful extensions: 1181 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1173 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -