BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24829| Best HMM Match : Gelsolin (HMM E-Value=5.8e-35) 123 8e-29 SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) 116 9e-27 SB_14143| Best HMM Match : Gelsolin (HMM E-Value=1.1e-07) 56 2e-08 SB_7860| Best HMM Match : Gelsolin (HMM E-Value=0.0032) 54 7e-08 SB_54820| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14141| Best HMM Match : HH_signal (HMM E-Value=0) 44 1e-04 SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) 42 3e-04 SB_38607| Best HMM Match : Gelsolin (HMM E-Value=0.0024) 42 3e-04 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 42 3e-04 SB_14633| Best HMM Match : LRR_1 (HMM E-Value=3.4e-12) 38 0.005 SB_32906| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.047 SB_49838| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 32 0.25 SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_4027| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_659| Best HMM Match : DUF265 (HMM E-Value=5.2) 29 2.3 SB_52882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 28 4.1 SB_54577| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 28 5.4 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 28 5.4 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 27 7.1 SB_44933| Best HMM Match : zf-TRAF (HMM E-Value=2.4e-25) 27 7.1 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 27 7.1 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 27 7.1 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_38437| Best HMM Match : VWA (HMM E-Value=0) 27 7.1 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 27 7.1 SB_32246| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 27 7.1 SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 27 7.1 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 27 7.1 SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) 27 7.1 SB_55017| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 27 7.1 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 27 7.1 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 27 7.1 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 27 7.1 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 27 7.1 SB_29123| Best HMM Match : ATP-synt_F (HMM E-Value=0.26) 27 7.1 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 27 7.1 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_50341| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_13297| Best HMM Match : RnaseH (HMM E-Value=0.37) 27 9.4 >SB_24829| Best HMM Match : Gelsolin (HMM E-Value=5.8e-35) Length = 1078 Score = 123 bits (297), Expect = 8e-29 Identities = 64/132 (48%), Positives = 84/132 (63%), Gaps = 2/132 (1%) Frame = +2 Query: 122 DKNA-RDKAKVHPAFANVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIILRTTSDS 298 +KN R+ A A+ N G G+QIWRI+ F+ +++D G FY GDSYIIL T +S Sbjct: 455 EKNVKREAAATEIAWKNAGTREGLQIWRIEKFKVKVWSREDYGSFYDGDSYIILNTYKES 514 Query: 299 -RNNLSWDIHYWIGRESTQDESGAAAILTVGLDDKFGGAAVQHRETMGHESALFLSYFQT 475 + L +D+H+WIG++STQDE G AA TV LD +QHRE G ES LF SYF++ Sbjct: 515 GEDELKYDVHFWIGKDSTQDEYGTAAYKTVELDIHLNDKPIQHREVQGFESKLFKSYFKS 574 Query: 476 PLTYLEGGNPSG 511 LT L+GG SG Sbjct: 575 -LTILKGGVDSG 585 Score = 71.3 bits (167), Expect = 4e-13 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +2 Query: 227 VAQKDIGKFYKGDSYIILRTTSD-SRNNLSWDIHYWIGRESTQDESGAAAILTVGLD 394 V + D GKFY GDSYIIL T D + L +D+H+WIG++STQDE G AA TV LD Sbjct: 880 VLRDDYGKFYDGDSYIILNTYKDPEEDELKYDVHFWIGKDSTQDEYGTAAYKTVELD 936 >SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) Length = 1531 Score = 116 bits (280), Expect = 9e-27 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 2/137 (1%) Frame = +2 Query: 107 ITSLSDKNARDKAKVHPAFANVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIILRT 286 ++ ++ + + A+ A+ N G G+QIWRI F+ ++ G+FY GDSYIIL T Sbjct: 496 LSEVTHEVKKSAAEGEVAWKNAGEKVGLQIWRINKFKVEEWPKEKYGQFYAGDSYIILWT 555 Query: 287 TSDSRNN--LSWDIHYWIGRESTQDESGAAAILTVGLDDKFGGAAVQHRETMGHESALFL 460 + + L +D+H+WIGR STQDE G AA TV LD VQHRE M HES +F Sbjct: 556 YEEKEDTEKLCYDLHFWIGRGSTQDEYGTAAYKTVELDTYLNDVPVQHREIMNHESDMFK 615 Query: 461 SYFQTPLTYLEGGNPSG 511 +YF++ +TYL+GG +G Sbjct: 616 TYFKS-ITYLKGGAETG 631 >SB_14143| Best HMM Match : Gelsolin (HMM E-Value=1.1e-07) Length = 546 Score = 55.6 bits (128), Expect = 2e-08 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = +2 Query: 173 GRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIILRTTSDSRNNLSWDIHYWIGRESTQ 352 GR+ V +R+ + + G F+ GDSY+++ T R I++W G +S Sbjct: 155 GRSKEVGFYRVTDGGKVQCNTAAKGIFFSGDSYLVVYTYRTQRGQKKSIIYFWKGNDSRV 214 Query: 353 DESGAAAILTVGLD-DKFGGAAVQ 421 E GAAA LTV LD + FGG AVQ Sbjct: 215 FEKGAAAKLTVDLDNNNFGGDAVQ 238 >SB_7860| Best HMM Match : Gelsolin (HMM E-Value=0.0032) Length = 675 Score = 54.0 bits (124), Expect = 7e-08 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +2 Query: 122 DKNAR-DKAKVHPAFANVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIILRT 286 +KN + + A+ PA+ G+ GVQ+WRI F+ ++D G FY GDSYI+L T Sbjct: 347 EKNVKKESAEGEPAWEGAGKEVGVQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNT 402 >SB_54820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 313 Score = 44.0 bits (99), Expect = 8e-05 Identities = 19/44 (43%), Positives = 25/44 (56%) Frame = +2 Query: 149 VHPAFANVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIIL 280 V AF G+ G++IWRI+ + + K G FY GDSYI L Sbjct: 3 VDDAFVQAGQKPGLEIWRIEKLKVVAQDPKTYGTFYSGDSYICL 46 >SB_14141| Best HMM Match : HH_signal (HMM E-Value=0) Length = 754 Score = 43.6 bits (98), Expect = 1e-04 Identities = 25/70 (35%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +2 Query: 251 FYKGDSYIILRTTSDSRNNLSWDIHYWIGRESTQDESGAAAILTVGLDDK-FGGAAVQHR 427 FY GDSY+IL D N +H G+ ++ DE AA + +DD+ FGG A Q Sbjct: 677 FYDGDSYVILDYRKDKTNKKQPVLHILHGKNASTDELFFAATKAIAIDDEYFGGKAKQTV 736 Query: 428 ETMGHESALF 457 + E F Sbjct: 737 QVCCREKVQF 746 >SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) Length = 341 Score = 41.9 bits (94), Expect = 3e-04 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +2 Query: 317 DIHYWIGRESTQDESGAAAILTVGLDDKFGGAAVQHRETMGHESALFLSYFQT 475 ++H+W+G E + +E AA V L K G VQ+RE G+E+ F FQ+ Sbjct: 22 NLHFWVGSECSAEEYCTAAYKAVELFVKLEGKPVQYREAEGYETEEFRKCFQS 74 >SB_38607| Best HMM Match : Gelsolin (HMM E-Value=0.0024) Length = 693 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 16/96 (16%) Frame = +2 Query: 167 NVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIIL--------RTTSDSRNNLSWDI 322 N+ T GV +W I + + ++ G F+ G+ Y+I R +D ++ + Sbjct: 214 NLCNTVGVTVWHINEYRHYELPNENHGHFHSGEGYVIRWAYFVMTDRIATDRKSRCRSTV 273 Query: 323 --------HYWIGRESTQDESGAAAILTVGLDDKFG 406 +W G + T +E GAAA++ V LD++ G Sbjct: 274 AGRVRTAYFFWQGNDCTVNEKGAAAVMAVELDEERG 309 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 16/96 (16%) Frame = +2 Query: 167 NVGRTAGVQIWRIQNFEPIPVAQKDIGKFYKGDSYIIL--------RTTSDSRNNLSWDI 322 N+ T GV +W I + + ++ G F+ G+ Y+I R +D ++ + Sbjct: 1769 NLCNTVGVTVWHINEYRHYELPNENHGHFHSGEGYVIRWAYFVMTDRIATDRKSRCRSTV 1828 Query: 323 --------HYWIGRESTQDESGAAAILTVGLDDKFG 406 +W G + T +E GAAA++ V LD++ G Sbjct: 1829 AGRVRTAYFFWQGNDCTVNEKGAAAVMAVELDEERG 1864 >SB_14633| Best HMM Match : LRR_1 (HMM E-Value=3.4e-12) Length = 446 Score = 37.9 bits (84), Expect = 0.005 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 278 LRTTSDSRNNLSWDIHYWIGRESTQDESG 364 L+T D + L W I+YWIG+E++++E G Sbjct: 260 LKTELDETDQLFWQIYYWIGKEASREEQG 288 >SB_32906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 34.7 bits (76), Expect = 0.047 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 326 YWIGRESTQDESGAAAILTVGLDDKFG-GAAVQHRETMGHESALFLSYFQTPLTYLEGGN 502 +W G +ST +E GAAA++TV +D + G +H T+ + F Y + + G+ Sbjct: 197 FWQGHDSTVNEKGAAALMTVEIDSEKGPQITFKHTVTVRFDIDTFFIYRECSCFFYCDGH 256 Query: 503 PSG 511 G Sbjct: 257 ALG 259 >SB_49838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 33.5 bits (73), Expect = 0.11 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 326 YWIGRESTQDESGAAAILTVGLDDKFG 406 +W G +ST +E GAAA++TV +D + G Sbjct: 37 FWQGHDSTVNEKGAAALMTVEIDSEKG 63 >SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 659 Score = 32.3 bits (70), Expect = 0.25 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +3 Query: 252 STKEIHTSFYGRPRTVATIYHGISTTGSVGSR--RKTSQEPPQSSPLAWTTSSGAPRSST 425 +T + ++ +P+T + I H ST S TS +P +SSP+ TTS+ SST Sbjct: 59 TTTTVGSTILTQPQTSSAICHTTSTQPHTSSAVGHTTSTKPQKSSPIGPTTSTQPQTSST 118 Score = 30.7 bits (66), Expect = 0.76 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +3 Query: 285 RPRTVATIYHGISTTGSVGSR--RKTSQEPPQSSPLAWTTSSGAPRSSTERP 434 +P+T +T+ H ST S TS +P SSP+ TTS+ SS P Sbjct: 112 QPQTSSTVGHTTSTQPQTSSTVGHTTSTKPQTSSPIGHTTSTKPQTSSPIGP 163 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 285 RPRTVATIYHGISTTGSVGSR--RKTSQEPPQSSPLAWTTSSGAPRSS 422 +P+T +T+ H ST S TS +P SSP+ TTS+ SS Sbjct: 126 QPQTSSTVGHTTSTKPQTSSPIGHTTSTKPQTSSPIGPTTSTQHQTSS 173 >SB_56230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = +1 Query: 256 QRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHRW-PGRQVRGRRGPAPRD 432 QRR+IH T G+S+ PL R+ V++R R + + G R RG R Sbjct: 803 QRRYIHMTTSTTGKSRNRRPYIPLATRTAVESRNQRRYIHMTTFTTGTGPRLPRGGIERQ 862 Query: 433 HGSRK 447 + RK Sbjct: 863 YNHRK 867 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 29.5 bits (63), Expect = 1.8 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 6/112 (5%) Frame = +3 Query: 123 IKTPVTKPKSIRL--LPMSAEQPVCKYGEYRTSNQYPLL--RRT*ENSTKEIHTSFYGRP 290 IK VT P +I LP++ P + TS Q + T +S+K+ T Sbjct: 632 IKCSVTSPPTITTHSLPVATSLPKQQTSPKVTSPQQTSTSPQETSTSSSKQTSTQQTSSS 691 Query: 291 RTVATIYHGISTTGSVGSRRKTSQEPPQS--SPLAWTTSSGAPRSSTERPWV 440 + +T +T+ S ++TS PPQ+ SP TTS S +PW+ Sbjct: 692 QQTSTSPPQTTTSPS----QQTSTSPPQTTTSPSQQTTSPPPSSPSIGQPWI 739 >SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = +2 Query: 194 IWRIQNFEPIPVAQKDIGKFYKGDSYIILRTTSDSRN--NLSWDIHY--WIGR 340 IWR+Q Q +IG + ++ SD+R +LSW H+ W+ R Sbjct: 160 IWRLQRARNSDSCQSEIGVNFNSRPQLVTNEKSDTRTCLSLSWLSHFSRWLPR 212 >SB_4027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 135 VTKPKSIRLLPMSAEQPVCKYGEYRTSNQYPLLRRT*ENSTKEI 266 +T K RLL +A +P+ K R++N+Y ++ +N K I Sbjct: 129 ITSTKEERLLVSTASKPIVKLSYNRSNNKYSYTGQSDDNLLKNI 172 >SB_659| Best HMM Match : DUF265 (HMM E-Value=5.2) Length = 229 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 279 YGRPRTVATIYHGISTTGSVGSRRKTSQEPPQSSPLAW 392 YG T+ +Y T G GS K + + SPLAW Sbjct: 106 YGGRYTLDVVYEVTKTLGLRGSSTKKKKRIKKKSPLAW 143 >SB_52882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1413 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/57 (29%), Positives = 33/57 (57%) Frame = +3 Query: 60 PSGHGRRPSLRR*AGRSHRCQIKTPVTKPKSIRLLPMSAEQPVCKYGEYRTSNQYPL 230 P+G ++PS +G+ + Q +TP++ KSI +P ++++P + S Q+PL Sbjct: 1317 PNGQLKQPSSIINSGQLQQLQYRTPISANKSI--IPQTSQEPTSS----QQSCQHPL 1367 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = +2 Query: 122 DKNARDKAKVHPAFANVGRTAGVQIWRIQNFEPIPVAQKDI-GKFYKGDSYIILRTTSDS 298 +KN KA + F G + G + I +PV +D Y+ ++ II+ TT + Sbjct: 694 NKNVTGKAGFYEEFE--GESRGTEKQYIAAQGCLPVTVEDFWAMVYQENTRIIVMTTKEV 751 Query: 299 RNNLSWDIHYWIGRESTQD 355 + YW E+T+D Sbjct: 752 ERGRNKCTRYWPDAETTKD 770 >SB_54577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 247 KILQRRFIHHFTDDLGQSQQSIMGYPLLDRS 339 + L RRFI + DLG+S+ +G+ L+ +S Sbjct: 43 RFLTRRFIGEYDKDLGESKYPSLGFRLVYQS 73 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/76 (26%), Positives = 34/76 (44%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + +++ +L+RSG+ R+ R Sbjct: 230 TYARQEKRLNTFHMRCLRRILGIHWSDKVTKNE-------VLERSGLPTLFTLIRQRRLR 282 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 283 WLGHVCRMENGRIPKD 298 >SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 796 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 246 ENSTKEIHTS-FYGRPRTVATIYHGISTTGSVGSRRKTSQEPPQSSPLAWTTSSGAPRSS 422 ++ST T +G P+T +I IS+ G T PQ++P + T+ + AP +S Sbjct: 242 QSSTSHSSTPRHHGEPQTTISITSIISSAIPRGHLPTTPSTTPQATPPSTTSQTTAPTAS 301 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 72 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 124 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 125 WLGHVCRMENGRIPKD 140 >SB_44933| Best HMM Match : zf-TRAF (HMM E-Value=2.4e-25) Length = 462 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 116 LSDKNARDKAKVHPAFAN-VGRTAGVQIWRIQNF 214 LSD ++ +K F+N VG G IWR+ NF Sbjct: 278 LSDLEKKESSKECSLFSNPVGSGYGELIWRVSNF 311 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 512 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 564 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 565 WLGHVCRMENGRIPKD 580 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 590 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 642 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 643 WLGHVCRMENGRIPKD 658 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 107 ITSLSDKNARDKAKVHPAFANVGRTAGVQIWRIQNFEPIPVAQKDIGKF 253 + S+S + + + + AF RT IWR +P+AQ+++G+F Sbjct: 1565 VRSVSSRGVKPRRWNYLAFTYDARTGLGTIWR----NSVPIAQRNLGRF 1609 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_32246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 337 SGVDARRVRSRRNPHRWPGRQVRGRRGPAPRDHGSRK 447 SG + R + + + +R R GPAPRD S K Sbjct: 259 SGEEFRLILQEQERYNTLKDAIRARHGPAPRDENSGK 295 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 27.5 bits (58), Expect = 7.1 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 10/109 (9%) Frame = +3 Query: 138 TKPKSIRLLPMSAEQPVCKYGEYRTSNQYPLLRRT*ENSTKEIHTSF----------YGR 287 T+P+S++ ++QP + + QYP + ++T + TS+ Y + Sbjct: 1791 TQPQSMQ---GPSQQPSVQQSQQYNGQQYPQAQSYAPSATSQTQTSYNSQSYPVSGAYSQ 1847 Query: 288 PRTVATIYHGISTTGSVGSRRKTSQEPPQSSPLAWTTSSGAPRSSTERP 434 P +V +G ST S S + SQ P S+ +TT+ P S ++P Sbjct: 1848 PSSVGYSTYGQSTAPS--SSQGYSQGGPPSTQATYTTT---PYQSMQQP 1891 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 121 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 173 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 174 WLGHVCRMENGRIPKD 189 >SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 192 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 6 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 58 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 59 WLGHVCRMENGRIPKD 74 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) Length = 886 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +3 Query: 249 NSTKEIHTSFYGRPRTVATIYHGISTTGSVGSRRKTSQEPPQSSPLAWTTSSGAPRSST 425 ++ +++ F PR T + TGS R + + P + AW +SG R T Sbjct: 395 STARKVDEIFSQDPRRPPTDRSSVDATGSTSRRAEVAFLPNKPHMKAWGNNSGNARPKT 453 >SB_55017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 341 PDRSSSGYPMIDCCDCPRSSVK*CMNLLCR--IFLCPSEQRVL 219 PD+ ++ P C DCP M ++ R IF C E +VL Sbjct: 57 PDKRTNTLPFTHCYDCPLIITSVYMGIMGRRGIFQCMLEVQVL 99 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 341 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 393 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 394 WLGHVCRMENGRIPKD 409 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 2432 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 2484 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 2485 WLGHVCRMENGRIPKD 2500 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 173 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 225 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 226 WLGHVCRMENGRIPKD 241 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 156 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 208 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 209 WLGHVCRMENGRIPKD 224 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 121 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 173 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 174 WLGHVCRMENGRIPKD 189 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_29123| Best HMM Match : ATP-synt_F (HMM E-Value=0.26) Length = 172 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 400 VRGRRGPAPRDHGSRK 447 +R RRGPAPRD S K Sbjct: 130 IRARRGPAPRDEKSGK 145 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 156 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 208 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 209 WLGHVCRMENGRIPKD 224 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 173 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 225 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 226 WLGHVCRMENGRIPKD 241 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.5 bits (58), Expect = 7.1 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +1 Query: 205 TELRTNTRCSEGHRKILQRRFIHHFTDDLGQSQQSIMGYPLLDRSGVDARRVRSRRNPHR 384 T R R + H + L+R H++D + ++ +L+RSG+ R+ R Sbjct: 40 TYARQEKRLNTFHMRCLRRILGIHWSDKVTNNE-------VLERSGLPTLFTLLRQRRLR 92 Query: 385 WPGRQVRGRRGPAPRD 432 W G R G P+D Sbjct: 93 WLGHVCRMENGRIPKD 108 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 284 TTSDSRNNLSWDIHYWIGRESTQDESGAAAILT 382 ++S+S N WD YW E+ + + AA +T Sbjct: 2031 SSSESLNRSKWDARYWAKFETERKKHQRAASMT 2063 >SB_50341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 284 TTSDSRNNLSWDIHYWIGRESTQDESGAAAILT 382 ++S+S N WD YW E+ + + AA +T Sbjct: 42 SSSESLNRSKWDARYWAKFETERKKHQRAASMT 74 >SB_13297| Best HMM Match : RnaseH (HMM E-Value=0.37) Length = 393 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = -3 Query: 207 CILHICTPAVLPTLAKAGWTLALSRAFLSDSDVIGPLIS*GLVAVRAQTDPRKTKRRHEK 28 C H+ TP L ++ +L ++ A S P+I + AV+ P +T R EK Sbjct: 316 CDAHVATPPPLCQQQQSAPSLVVTPAEWSRRQKEDPVIQKVMHAVKTNKQPMQTTSREEK 375 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,622,384 Number of Sequences: 59808 Number of extensions: 453841 Number of successful extensions: 1628 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -