BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|ch... 29 0.32 SPAC4A8.09c |cwf21||complexed with Cdc5 protein Cwf21 |Schizosac... 25 9.0 >SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 764 Score = 29.5 bits (63), Expect = 0.32 Identities = 21/67 (31%), Positives = 40/67 (59%) Frame = +2 Query: 80 TKRRGKLQSNHNVAPIQVDNVINNIDRSYNDMKITISRPFASNAVVQINLSHVLKAVVAF 259 TK++ K S +VAP +VDN ++I++S + + + PF + ++ +H+L VV F Sbjct: 608 TKKKNKHASETSVAPEKVDN--SSIEQSSSFLTKLYTFPFTIITWL-MHPTHLL-LVVMF 663 Query: 260 KGLLMEW 280 L+++W Sbjct: 664 SMLVLQW 670 >SPAC4A8.09c |cwf21||complexed with Cdc5 protein Cwf21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 293 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 161 SYNDMKITISRPFASNAVVQINLSHVLK 244 SYN + + R +N V NLSHV K Sbjct: 2 SYNGIGLPTPRGSGTNGYVMRNLSHVKK 29 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,803,744 Number of Sequences: 5004 Number of extensions: 33932 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -