BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E06f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66450.1 68414.m07549 DC1 domain-containing protein contains ... 27 5.8 At2g27320.1 68415.m03284 hypothetical protein contains Pfam pr... 27 7.7 >At1g66450.1 68414.m07549 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 700 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 209 HYLQMVLIW*FSYRYRICLCC 147 H LQ+VL W +++ R C CC Sbjct: 209 HSLQLVLWWVSNFQKRKCYCC 229 >At2g27320.1 68415.m03284 hypothetical protein contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 339 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +2 Query: 2 IHEYSSFAHTLLSQNSLKRSYINSGSTKRRGKLQSNHNVAP 124 I++ +F H LL + ++ + ++ KR+ + Q N P Sbjct: 35 IYKQPAFQHPLLKHHKIQEKFSSNEKLKRKDEYQPNEKYCP 75 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,318,701 Number of Sequences: 28952 Number of extensions: 172792 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -