BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307E05f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g20170.1 68416.m02557 armadillo/beta-catenin repeat family pr... 30 1.1 At1g49290.1 68414.m05525 expressed protein ; expression supporte... 30 1.1 >At3g20170.1 68416.m02557 armadillo/beta-catenin repeat family protein contains Pfam profile: PF00514 armadillo/beta-catenin-like repeat Length = 475 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = -3 Query: 513 RPVASSSTIPL*LQMVSGINFIGAITSERRFCVL 412 RPV + +IPL ++++SG + +G +E FC+L Sbjct: 269 RPVTEAGSIPLYVELLSGQDPMGKDIAEDVFCIL 302 >At1g49290.1 68414.m05525 expressed protein ; expression supported by MPSS Length = 338 Score = 29.9 bits (64), Expect = 1.1 Identities = 19/62 (30%), Positives = 25/62 (40%) Frame = -2 Query: 436 KRATVLCTRAFEDACFTVERFARTVLFFLGMRRFSLKVNVFRICPVQRSELRRPVTASAV 257 K T +CTRAF D C T R R L +F + R+ Q R V + Sbjct: 143 KSWTDVCTRAFSDLCETAHRINREKQLALEREKFIEDMKKLRLSLQQEKSNRLSVQQVKI 202 Query: 256 AT 251 A+ Sbjct: 203 AS 204 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,341,171 Number of Sequences: 28952 Number of extensions: 230748 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -