BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 96 6e-22 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 6.2 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.2 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 8.2 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 96.3 bits (229), Expect = 6e-22 Identities = 51/145 (35%), Positives = 85/145 (58%), Gaps = 3/145 (2%) Frame = +3 Query: 48 WKEVDYEWNTPAERENAIKSGDFVPANNLPLGLGRWKNKLFVTVPKWKNGVASSLNYVDL 227 W+ V+Y+ PAE + ++P N+P+G KN++FV V + + G+ S+LN VDL Sbjct: 29 WQRVEYD--VPAEVLQ--RENGYIPIGNIPMGAVHHKNRVFVAVARRRWGIPSTLNVVDL 84 Query: 228 NG---TSDQLLKPYPSLKDNFIPDSAKDLPSNKTIISVFRIYIDPCDRLWVMDTGLADIW 398 + ++ +LKPYP+ N + + P I++V+R +D CDRLW +DTG+ +I Sbjct: 85 SPPFPNTNVILKPYPNFALNELRADLQ--PDANRIVTVYRPRVDRCDRLWFVDTGMMEIP 142 Query: 399 GAGNQIVRPSIVIFDLKTDQLLHRY 473 G + RPS+ DL T++ +HR+ Sbjct: 143 GNFTVVQRPSVWSIDLNTNEPIHRF 167 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 135 PLGLGRWKNKLFVTVPKWKNGVA 203 P G +N F+ +P+W NG A Sbjct: 1125 PTGYPEKENDDFIHMPRWFNGSA 1147 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 192 SSTWAPLQTICFSIALSPKAN 130 ++ W L+ F +++SPK N Sbjct: 2863 ATVWGALEGASFGLSISPKLN 2883 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -3 Query: 306 ANPLLNPE*SCLLAMDTALEVDLRYHSNQHNSTKKRHHSSTW 181 A PLL +C++ M + V N H+ H S W Sbjct: 273 AVPLLGTYFNCIMFMVASSVVSTILILNYHHRNSDTHEMSEW 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,711 Number of Sequences: 2352 Number of extensions: 12767 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -