BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D11f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20650.1 68414.m02587 protein kinase family protein contains ... 29 1.9 At4g26720.1 68417.m03851 serine/threonine protein phosphatase PP... 29 2.5 At4g18425.1 68417.m02734 expressed protein contains Pfam profile... 28 3.3 At5g01260.2 68418.m00035 glycoside hydrolase starch-binding doma... 28 4.4 At5g01260.1 68418.m00034 glycoside hydrolase starch-binding doma... 28 4.4 At5g53440.1 68418.m06641 expressed protein 27 5.8 At2g39630.2 68415.m04859 glycosyl transferase family 2 protein s... 27 5.8 At2g39630.1 68415.m04858 glycosyl transferase family 2 protein s... 27 5.8 >At1g20650.1 68414.m02587 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 585 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 150 RWKNKLFVTVPKWKNGV-ASSLNYVDLNGTSDQLLKP 257 +W + ++V P WKN + + L +V + T D +L P Sbjct: 143 QWSSYIYVLPPPWKNIIEETKLRFVGTSDTGDIVLSP 179 >At4g26720.1 68417.m03851 serine/threonine protein phosphatase PP-X isozyme 1 (PPX1) identical to SP|P48529 Serine/threonine protein phosphatase PP-X isozyme 1 (EC 3.1.3.16) {Arabidopsis thaliana}; contains Pfam profile PF00149: Ser/Thr protein phosphatase Length = 305 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 366 WVMDTGLADIWGAGNQIVRPSIVIFDLKTDQLLHRYFFKLEDMKEDS 506 W+ D+ + +W A N R V L+ D+ L++ F + ++DS Sbjct: 245 WMFDSQIVTVWSAPNYCYRCGNVASILELDENLNKEFRVFDAAQQDS 291 >At4g18425.1 68417.m02734 expressed protein contains Pfam profile PF05078: Protein of unknown function (DUF679) Length = 213 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 132 LPLGLGRWKNKLFVTVPKWKNGVASSLN 215 LP+G+G + + LF T P +NG+ L+ Sbjct: 184 LPVGVGVFSSMLFATFPTTRNGIGFPLS 211 >At5g01260.2 68418.m00035 glycoside hydrolase starch-binding domain-containing protein low similarity to SP|P31797 Cyclomaltodextrin glucanotransferase precursor (EC 2.4.1.19) (Cyclodextrin-glycosyltransferase) (CGTase) {Bacillus stearothermophilus}; contains Pfam profile PF00686: Starch binding domain Length = 385 Score = 27.9 bits (59), Expect = 4.4 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 6/77 (7%) Frame = +3 Query: 129 NLPLGLGRWKNKLFVTVPKWKNGVASSLNYVDLNGT-SDQLLKPYP----SLKDNFIPDS 293 +LP G+ R+ ++F +VP+ + ++ L+ S ++LKP P S+KD+ + Sbjct: 20 DLPPGIYRYGTEIFTSVPR---KTFHHIKFLRLDSAQSSRILKPVPLRSSSIKDSQVNVE 76 Query: 294 AKDL-PSNKTIISVFRI 341 +++ SNKT+ F++ Sbjct: 77 DEEIEASNKTVRVRFQL 93 >At5g01260.1 68418.m00034 glycoside hydrolase starch-binding domain-containing protein low similarity to SP|P31797 Cyclomaltodextrin glucanotransferase precursor (EC 2.4.1.19) (Cyclodextrin-glycosyltransferase) (CGTase) {Bacillus stearothermophilus}; contains Pfam profile PF00686: Starch binding domain Length = 306 Score = 27.9 bits (59), Expect = 4.4 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 6/77 (7%) Frame = +3 Query: 129 NLPLGLGRWKNKLFVTVPKWKNGVASSLNYVDLNGT-SDQLLKPYP----SLKDNFIPDS 293 +LP G+ R+ ++F +VP+ + ++ L+ S ++LKP P S+KD+ + Sbjct: 20 DLPPGIYRYGTEIFTSVPR---KTFHHIKFLRLDSAQSSRILKPVPLRSSSIKDSQVNVE 76 Query: 294 AKDL-PSNKTIISVFRI 341 +++ SNKT+ F++ Sbjct: 77 DEEIEASNKTVRVRFQL 93 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/66 (19%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Frame = +3 Query: 78 PAERENAIKSGDFVPANNLPLGLGRWKNKLFVTVPKWKNGVASS---LNYVDLNGTSDQL 248 P E +N + +G + +GR ++ ++ VP W + +++ +V +G + Sbjct: 614 PREEDNRVNTGGRYKRGGVDAMMGRGQSNMWRGVPSWPSPLSNGYFPFQHVPPHGAFQTM 673 Query: 249 LKPYPS 266 + +PS Sbjct: 674 MPQFPS 679 >At2g39630.2 68415.m04859 glycosyl transferase family 2 protein similar to dolichyl-phosphate beta-glucosyltransferase from Saccharomyces cerevisiae [SP|P40350]; contains Pfam glycosyltransferase group 2 domain PF00535 Length = 236 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +1 Query: 334 LEFTLTLVTDFGLWILVLLIFG 399 +EF +T V +F LW+L++++FG Sbjct: 1 MEFLVT-VAEFSLWLLLIVLFG 21 >At2g39630.1 68415.m04858 glycosyl transferase family 2 protein similar to dolichyl-phosphate beta-glucosyltransferase from Saccharomyces cerevisiae [SP|P40350]; contains Pfam glycosyltransferase group 2 domain PF00535 Length = 336 Score = 27.5 bits (58), Expect = 5.8 Identities = 10/22 (45%), Positives = 18/22 (81%) Frame = +1 Query: 334 LEFTLTLVTDFGLWILVLLIFG 399 +EF +T V +F LW+L++++FG Sbjct: 1 MEFLVT-VAEFSLWLLLIVLFG 21 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,643,732 Number of Sequences: 28952 Number of extensions: 251358 Number of successful extensions: 669 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -