BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 24 1.1 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 3.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 3.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.7 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 457 AESGQTQVPEYSSK*RPAVHLTSVASP 377 AES + P++ + P+ HL ++SP Sbjct: 35 AESSASNSPDHYERFSPSTHLMDLSSP 61 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 3.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 235 LLIFLIVGSNTRPSGQSLVVATPSTHSKNL 146 LL FL++ S TRPS + A PS+ N+ Sbjct: 7 LLFFLLLSSCTRPSRGN---AVPSSQRGNV 33 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 3.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 235 LLIFLIVGSNTRPSGQSLVVATPSTHSKNL 146 LL FL++ S TRPS + A PS+ N+ Sbjct: 7 LLFFLLLSSCTRPSRGN---AVPSSQRGNV 33 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 7.7 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = -2 Query: 337 GWAKNPLRRGHCELGLGGWSSVLSPQSTLKGWSHLLIFLIVGSNTR 200 GW+ L E + G SV + +KG+ + L V +N R Sbjct: 377 GWSARGLVSDGNEAEVEGTLSVQPQANPVKGFEEYFLNLTVENNRR 422 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,848 Number of Sequences: 438 Number of extensions: 3137 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -