BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 25 0.62 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.4 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 22 4.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.8 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 24.6 bits (51), Expect = 0.62 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +2 Query: 152 HPHHEEHYASSGHGWGRSIDDAQNMAYSAHIKSD*ITAQKFFGPP 286 H HH H+A GH G + Q + D + +F PP Sbjct: 280 HVHHANHHAILGHS-GFLCERHQKRYFFGRDSVDHVDFDEFLPPP 323 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 101 KKLLASKHTETSYEVVAHPHHEEHYASSGH 190 +KLLA K TE ++ A H++ + H Sbjct: 404 EKLLAFKMTEQQQQMQAQQQHQQQQQQTQH 433 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 400 KVRSVFVCSLYTILVFLLKLLYG 468 K +++ SLY L+ + L+YG Sbjct: 2 KAAEIWLVSLYWYLILQIALVYG 24 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 167 EHYASSGHGWGRSIDDAQNMAYS 235 +HY S G RS+ A+N+ S Sbjct: 1832 DHYGSRGSVGRRSVGSARNIPVS 1854 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,532 Number of Sequences: 438 Number of extensions: 2505 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -