BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D08f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101313-1|AAC69223.1| 1802|Caenorhabditis elegans Abc transport... 29 2.7 Z81584-9|CAB04680.2| 334|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AF101313-1|AAC69223.1| 1802|Caenorhabditis elegans Abc transporter family protein 4 protein. Length = 1802 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 112 KCC*H*PWHEQYFAESFHLTNHYDEDIYP-VYSTYKQVTLYIPTGHI 249 +CC + +Q + + +HLT YD P V T + YIP H+ Sbjct: 806 ECCGSPMFLKQQYGDGYHLTIVYDTTSTPDVSKTTDIIREYIPEAHV 852 >Z81584-9|CAB04680.2| 334|Caenorhabditis elegans Hypothetical protein T04C12.2a protein. Length = 334 Score = 27.1 bits (57), Expect = 8.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 258 VLYNVTCWYVQCDLFVCTINRINVFIVMVC*ME-GLCEVLLMPGSV 124 VL N CW D+ +C++ F + GL VL +P SV Sbjct: 66 VLLNTHCWCCYVDILICSLITPYFFFPTISGFPVGLLRVLKVPTSV 111 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,550,197 Number of Sequences: 27780 Number of extensions: 231929 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -