BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D07f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CA448 Cluster: hypothetical protein TTHERM_0049... 32 9.2 UniRef50_A6D808 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 >UniRef50_UPI00006CA448 Cluster: hypothetical protein TTHERM_00497080; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00497080 - Tetrahymena thermophila SB210 Length = 1797 Score = 31.9 bits (69), Expect = 9.2 Identities = 20/56 (35%), Positives = 29/56 (51%) Frame = -3 Query: 492 NSVFESTIIKAGNVTFGQLLVNQKNELLTLYSIGSHKTVLNDILDK*QVKY*PLFN 325 N +F +T V LL+N +NE + L+ IGS+K + N IL +Y L N Sbjct: 147 NLIFLTTTYSGIYVFEQMLLLNNQNEQVFLFEIGSYKQMQNTILMTSDGQYLVLLN 202 >UniRef50_A6D808 Cluster: Putative uncharacterized protein; n=1; Vibrio shilonii AK1|Rep: Putative uncharacterized protein - Vibrio shilonii AK1 Length = 394 Score = 31.9 bits (69), Expect = 9.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 160 SHAKLTRLRVER*MSRLLSKVAGNLCIWTKK 252 SHA LT V + SR+ S+++G +W+KK Sbjct: 28 SHANLTPEEVRQTRSRVFSEISGTYAVWSKK 58 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,502,699 Number of Sequences: 1657284 Number of extensions: 8866867 Number of successful extensions: 15483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15478 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -