BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D07f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC087081-11|AAK66034.2| 328|Caenorhabditis elegans Hypothetical... 30 1.2 Z81533-8|CAB04332.1| 917|Caenorhabditis elegans Hypothetical pr... 27 6.2 AC006834-7|AAF40003.2| 176|Caenorhabditis elegans Lipid deplete... 27 8.1 >AC087081-11|AAK66034.2| 328|Caenorhabditis elegans Hypothetical protein Y82E9BL.7 protein. Length = 328 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 77 VVLQYADLRHSYL*HICRCT*KNMTASHLMRN*RA*EWN 193 ++L+YA H H C T TA HL+R A +WN Sbjct: 128 ILLRYASKLHISSVHTCYKTDMYFTAKHLLRTLTAKKWN 166 >Z81533-8|CAB04332.1| 917|Caenorhabditis elegans Hypothetical protein F36G9.13 protein. Length = 917 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 493 KFSI*VDYYQSR*CDFWTIIGKSEKRIIDFVFHWQSQNCSERHLR 359 +F+I VD + C +I S II F++ W+ QNC LR Sbjct: 738 EFAIVVDTNSTLVCTVTVLIIGSILGIIAFLWCWRDQNCIYHKLR 782 >AC006834-7|AAF40003.2| 176|Caenorhabditis elegans Lipid depleted protein 5 protein. Length = 176 Score = 27.1 bits (57), Expect = 8.1 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -3 Query: 477 STIIKAGNVTFGQLLVNQKNELLTLYSIGSHKTVLNDILDK 355 S + AGN F + L K+ L S + K LNDILDK Sbjct: 7 SRCLSAGNTAF-RCLSTGKDNLPVTRSHDAKKVELNDILDK 46 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,420,245 Number of Sequences: 27780 Number of extensions: 224171 Number of successful extensions: 392 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -