BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307D01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 26 0.67 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.2 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 1.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.5 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 23 6.2 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 26.2 bits (55), Expect = 0.67 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 385 FYNILGLD*ITTNQDLINSIKARLCHISHLNNVLRHIYKLLL 260 F NILG D I Q L + K+ CH S ++ V + LL Sbjct: 831 FDNILGRDTINILQLLTSETKSIFCHSSMVDRVAAMLNYFLL 872 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 141 ISNFNCF*CIYESTIIKAGNVTFGQLLVNQK 49 I NFNC IY + + AGN F ++ + + Sbjct: 538 IENFNCDKSIYTAVEVTAGNRLFHHIVESDR 568 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 25.4 bits (53), Expect = 1.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 235 YYLIVI*QDNIEGMRGIDDGSHDMILTYPIEHFKFQLLLMHI 110 YY++ N +G G+D SHD+ + ++ K L +HI Sbjct: 1432 YYIV---HGNEDGHFGLDPVSHDLTVEKELDREKKSLYKLHI 1470 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 1.5 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = +3 Query: 477 TYDGWHWSKK 506 TYDG+HW+K+ Sbjct: 1076 TYDGFHWNKR 1085 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -2 Query: 376 ILGLD*ITTNQDLINSIKARL 314 I+ LD ITT +++ S+KA+L Sbjct: 199 IMHLDEITTPEEVAESVKAQL 219 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,687 Number of Sequences: 2352 Number of extensions: 7967 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -