BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307C03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 36 0.027 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_3839| Best HMM Match : Lep_receptor_Ig (HMM E-Value=6) 32 0.25 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 31 0.44 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 31 0.58 SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) 30 1.0 SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) 30 1.0 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54595| Best HMM Match : Sec7 (HMM E-Value=7.7e-09) 29 2.3 SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) 28 4.1 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 4.1 SB_40962| Best HMM Match : COLFI (HMM E-Value=1.4013e-45) 28 5.4 SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) 28 5.4 SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052) 28 5.4 SB_56121| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_22339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) 27 7.1 SB_6911| Best HMM Match : Ank (HMM E-Value=0) 27 7.1 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_28356| Best HMM Match : AAA_5 (HMM E-Value=0) 27 9.4 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 35.5 bits (78), Expect = 0.027 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = +1 Query: 103 ESEIDSPVGTPQPPAIPNQVSPPG----PIPTQTFTNQHYVQLPGGR 231 +S ++S P PP IP + SPPG PIPTQ N HY LPG + Sbjct: 358 KSSLESAPRKPSPP-IPEE-SPPGAMAAPIPTQD--NNHYPSLPGSK 400 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 35.5 bits (78), Expect = 0.027 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Frame = +1 Query: 103 ESEIDSPVGTPQPPAIPNQVSPPG----PIPTQTFTNQHYVQLPGGR 231 +S ++S P PP IP + SPPG PIPTQ N HY LPG + Sbjct: 325 KSSLESAPRKPSPP-IPEE-SPPGAMAAPIPTQD--NNHYPSLPGSK 367 >SB_3839| Best HMM Match : Lep_receptor_Ig (HMM E-Value=6) Length = 286 Score = 32.3 bits (70), Expect = 0.25 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +2 Query: 317 CPCRPYLRTRTVLCPPIYR--PRCRLSRTPPLHLSPYITQCNPLSSRLWYTSLLRPFCKK 490 C RP+ R PP+ P R PLHL P T S+ L+ + L+RP+C Sbjct: 181 CLVRPWCSARVRSSPPLASLDPGVR-QEYGPLHLLPRWTLVFGKSTVLFTSCLVRPWCSA 239 Query: 491 ILRRXSPV 514 +R PV Sbjct: 240 RVRSSPPV 247 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +1 Query: 10 RHEEHAYFAQQYPQQRPITEVIGSQNFFFLQESEIDSPVGTPQPPAIPNQVSPPGPIP 183 R + +YF Q + + + +Q + ++ + V TP P +PN V P P P Sbjct: 1216 RKGDTSYFRGQISCMQVYDKPLNAQQIVYARDICDNLQVSTPSPSLVPNPVPQPAPAP 1273 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 31.1 bits (67), Expect = 0.58 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 121 PVGTPQPPAIPNQVSPPGPIPTQTFTNQHYVQLPG 225 P+G P +P PPGP P TF + H+ Q G Sbjct: 898 PMGPMGDPGLPGPPGPPGP-PVSTFYHHHHHQHHG 931 >SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) Length = 1084 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +2 Query: 311 HPCP--CRPYLRTRTVLCPPIYRPRCRLSRTPPLHLSPYITQCN 436 HPCP C + T L P I P C+ + P H+ P+ +C+ Sbjct: 320 HPCPLPCFEECKPCTELLPKII-PECQHEQQVPCHIDPWEFKCS 362 >SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) Length = 1799 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = +3 Query: 333 TYAPARSSARQSTAPAAACHARRPSTSARTSHNATRSRRDSGTRLCYARSAKRY 494 +Y+P + RQ P+ RTSHN + DSG Y S K Y Sbjct: 1571 SYSPGKHQRRQGHKERIIASQNSPAAKIRTSHN--KEPNDSGPAWFYPVSNKHY 1622 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +3 Query: 306 TGTRAHAARTYAPARSSARQSTAPAAACHARRPSTSARTSHNATRS 443 +G + ++T P + +QST P A H RR ST R+ +++ S Sbjct: 1093 SGPVSLTSKTPGPVSLTTKQSTKPEAKKHKRRSSTPERSDSDSSVS 1138 >SB_54595| Best HMM Match : Sec7 (HMM E-Value=7.7e-09) Length = 918 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 326 RPYLRTRTVLCPPIYRPRCRLSRTPPLHLSPYITQCN 436 +PYLRT TV P + + +L RT L P C+ Sbjct: 324 KPYLRTFTVADPKVQLYQAKLHRTASAPLGPQRISCS 360 >SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) Length = 482 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +3 Query: 309 GTRAHAARTYAPARSSARQSTAPAAACHARRPSTSARTSHNATRSR 446 G R A+ Y ARS ++ +A AA R AR+ +A+RSR Sbjct: 236 GPRGRAS--YRSARSGRQRDSARKAAAGGRTADQGARSGDSASRSR 279 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 118 SPVGT-PQPPAIPNQVSPPGPIPTQTFTNQHYVQLP 222 +P G P PPA P + PP P P TF N + P Sbjct: 192 APPGVLPPPPAPPGALIPPPPAP-PTFNNNQNMGYP 226 >SB_40962| Best HMM Match : COLFI (HMM E-Value=1.4013e-45) Length = 577 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 124 VGTPQPPAIPNQVSPPGPIPTQ 189 +G+ PP +P +V PGPI Q Sbjct: 49 MGSKGPPGVPGEVGKPGPIGYQ 70 >SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) Length = 763 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Frame = +1 Query: 4 RIRHEEHAYFAQQYPQQRPITEVIGSQ----NFFFLQESEIDSPVGTPQPPAIPNQVSPP 171 R+R +EH A Q+ Q+ +I +Q N S + P G P P +P P Sbjct: 136 RVR-KEHDAMAVQFKIQKHRITLIETQLKDINHTVRNTSRLPGPQGPPGPQGLPGPQGVP 194 Query: 172 GP 177 GP Sbjct: 195 GP 196 >SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052) Length = 532 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Frame = +2 Query: 230 ESRNLAACPCRLSLIFH----RIQSMQGLHRHPCPCRPYLRTRTVLCPPIYRPRCRLSRT 397 ++ ++ P R L +H + + Q H P R +L L PP ++ T Sbjct: 175 QTYHVTLTPPRKHLTYHVTLTQPRKHQTYHVTLTPPRKHLTYHVTLTPPRKHQTYHVTLT 234 Query: 398 PP-LHLSPYITQCNPLSSRLWYTSLLRP 478 PP HL+ ++T P + ++ +L P Sbjct: 235 PPRKHLTYHVTLTPPRKHQTYHVTLTPP 262 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +2 Query: 296 QGLHRHPCPCRPYLRTRTVLCPPIYRPRCRLSRTPP-LHLSPYITQCNPLSSRLWYTSLL 472 Q H P R +L L PP ++ TPP HL+ ++T P + ++ +L Sbjct: 227 QTYHVTLTPPRKHLTYHVTLTPPRKHQTYHVTLTPPRKHLTYHVTLTPPRKHQTYHVTLT 286 Query: 473 RP 478 P Sbjct: 287 PP 288 >SB_56121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +2 Query: 317 CPCRPYLRTRTVLCPPIYR--PRCRLSRTPPLHLSPYITQCNPLSSRLWYTSLLRPFCKK 490 C P+ R PP+ P R PLHL P T S+ L+ + L+ P+C Sbjct: 360 CLVGPWCSARVRSSPPVASLDPGVR-QEYGPLHLLPRWTLVYGKSTVLFTSCLVGPWCSA 418 Query: 491 ILRRXSPV 514 +R PV Sbjct: 419 RVRSSPPV 426 >SB_22339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +2 Query: 317 CPCRPYLRTRTVLCPPIYR--PRCRLSRTPPLHLSPYITQCNPLSSRLWYTSLLRPFCKK 490 C P+ R PP+ P R PLHL P T S+ L+ + L+ P+C Sbjct: 92 CLVGPWCSARVRSSPPVASLDPGVR-QEYGPLHLLPRWTLVYGKSTVLFTSCLVGPWCSA 150 Query: 491 ILRRXSPV 514 +R PV Sbjct: 151 RVRSSPPV 158 >SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) Length = 530 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 106 SEIDSPVGTPQPPAIPNQVSPPGPIP 183 S +P+ PPA+P +PP +P Sbjct: 404 SRTQAPIAVHVPPAVPQHPAPPPAVP 429 >SB_6911| Best HMM Match : Ank (HMM E-Value=0) Length = 1961 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +2 Query: 254 PCRLSLIFHRIQSMQGLHRHPCPCRP 331 P +++ + R+ M+ LH+H PC P Sbjct: 926 PMQIAAQYGRVSVMEVLHKHGAPCDP 951 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 133 PQPPAIPNQVSPPGPIP 183 PQPP +P+ +PP P P Sbjct: 1167 PQPPPVPSVQAPPAPPP 1183 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 103 ESEIDSPVGTPQPPAIPNQVSPPGP 177 E +D P G PP P Q PPGP Sbjct: 1047 EKGLDGPSG---PPGTPGQPGPPGP 1068 >SB_45305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = +1 Query: 4 RIRHEEHAYFAQQYPQQRPITEVIGSQNFFFLQESEIDSPVGTPQPPAIPNQVSPPGPIP 183 +++H +H QQ Q + NF F Q + + P P + Q P P P Sbjct: 118 QVKHVQH--LQQQIALQPQLNGYPSQINFSFPQTAAVTLPQQIQHPTQLSQQPQQPDPPP 175 Query: 184 T 186 T Sbjct: 176 T 176 >SB_28356| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 1737 Score = 27.1 bits (57), Expect = 9.4 Identities = 23/90 (25%), Positives = 32/90 (35%), Gaps = 3/90 (3%) Frame = +2 Query: 161 YRHLDLSQLRLLPINIMYNYPGVESRNLAACPCRLS---LIFHRIQSMQGLHRHPCPCRP 331 YRH ++ LL Y +P + L PC L R + L P P Sbjct: 1579 YRHPAITDTLLLQTPCYYRHPAITDTPLLQTPCYTDIPLLQTSRFTDIPLLQTSPYYRYP 1638 Query: 332 YLRTRTVLCPPIYRPRCRLSRTPPLHLSPY 421 + +L P Y ++ T L SPY Sbjct: 1639 TITDTLLLQTPSYYRHPAITDTLLLQTSPY 1668 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 297 RVCTGTRAHAA-RTYAPARSSARQSTAPAAACHARRPSTSARTSHNATRS 443 R GT + ++ ++ P RSS ST RPS++++ S++ TRS Sbjct: 19 RAKKGTSSTSSPKSSRPGRSSLASSTDSITQTSNARPSSASKPSNSRTRS 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,775,408 Number of Sequences: 59808 Number of extensions: 305908 Number of successful extensions: 1565 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -