BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307C03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 1.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 1.9 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 5.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 5.8 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 21 5.8 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 7.7 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 1.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 194 LPINIMYNYPGVE 232 LP+NI ++YPG E Sbjct: 612 LPLNIRWSYPGEE 624 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 174 SRWRYLIRNRGRLWCAYRTVNFRL 103 ++WR+L++ L C+ R +N RL Sbjct: 68 NKWRFLLQCLEDLDCSLRKLNSRL 91 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 40 QYPQQRPITEVIG 78 +Y Q +PI+EVIG Sbjct: 951 EYYQNKPISEVIG 963 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 404 LHLSPYITQCNPLSSRLW 457 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 404 LHLSPYITQCNPLSSRLW 457 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 216 LYIMLIGKSLSWDRSRWR 163 LYI+L+G WD + R Sbjct: 102 LYILLVGYPPFWDEDQHR 119 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 131 HHNRPRFLIKYRHLDLSQLRLLPINIMYNYPGVE 232 H N P FL + L L P MY+ G E Sbjct: 121 HDNSPSFLSDHSRDQEQNLYLTPSPQMYSSGGEE 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,968 Number of Sequences: 438 Number of extensions: 2817 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -