BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307C01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0488 - 3678329-3678577,3678769-3678810,3678891-3678944,367... 28 5.2 02_05_0685 + 30891289-30891810,30892740-30892915,30893379-308934... 27 9.1 >07_01_0488 - 3678329-3678577,3678769-3678810,3678891-3678944, 3679149-3679212,3679316-3679410,3679477-3679584, 3679679-3679752,3680338-3680410,3680539-3680586, 3680694-3680877,3681262-3681440,3682167-3682259, 3682738-3682851,3683570-3683644,3683852-3684112, 3684821-3684934,3685473-3685529,3686668-3686863, 3686922-3686986,3687112-3687195,3688155-3688223, 3688545-3688844 Length = 865 Score = 27.9 bits (59), Expect = 5.2 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 5/64 (7%) Frame = -1 Query: 272 FLC---SNIYDWKTIY*T*VTLVFYQFLVNEIFKDVDDSPLSSAAAG--EYLLLFDCKAD 108 FLC S + + +TI V ++ QF+VN + +DDS L AG +L+ + D Sbjct: 183 FLCRALSEVPNKQTIAGVRVGMINDQFVVNPTTEQMDDSELDLVMAGTDSAILMIEGYCD 242 Query: 107 *LTE 96 LTE Sbjct: 243 FLTE 246 >02_05_0685 + 30891289-30891810,30892740-30892915,30893379-30893492, 30893846-30893954,30894038-30894124,30895137-30895736, 30895823-30896101,30896808-30896897,30897151-30897507, 30897924-30898160,30898733-30898953,30899856-30899955, 30900042-30900188,30900287-30900385 Length = 1045 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 305 LNKLEIKLESITDWFAQLEVCGLEEALPVANIRQNGSLLDLKFRV*Y 445 + +LE + +T Q+E G +E L ++ + Q LD+ +V Y Sbjct: 830 IERLEARSRRLTRRIRQIEPTGWKEFLQISKVIQEARALDINTQVIY 876 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,198,958 Number of Sequences: 37544 Number of extensions: 214287 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -