BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B12f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine re... 27 6.2 U40948-4|AAA81730.2| 517|Caenorhabditis elegans Hypothetical pr... 27 8.1 AY849796-1|AAW34234.1| 517|Caenorhabditis elegans acetylcholine... 27 8.1 >U28929-5|AAA68348.2| 438|Caenorhabditis elegans Gaba/glycine receptor family (seegbr) protein 3 protein. Length = 438 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 248 IELIQVLNTKF*NI*YNL*KVVYVNDFGMWLFLCLYII 135 + + L +F NI NL +V +V +W F+C+ I Sbjct: 285 VSSLMALTFQFGNIVKNLPRVSFVKAIDLWFFVCVAFI 322 >U40948-4|AAA81730.2| 517|Caenorhabditis elegans Hypothetical protein F55D10.5 protein. Length = 517 Score = 27.1 bits (57), Expect = 8.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 248 IELIQVLNTKF*NI*YNL*KVVYVNDFGMWLFLCLYII 135 + + L +F NI NL +V YV +W+ +CL + Sbjct: 311 VNSLLALTFQFGNIMRNLPRVSYVKALDVWMLVCLTFV 348 >AY849796-1|AAW34234.1| 517|Caenorhabditis elegans acetylcholine-gated chloride channelsubunit ACC-3 protein. Length = 517 Score = 27.1 bits (57), Expect = 8.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 248 IELIQVLNTKF*NI*YNL*KVVYVNDFGMWLFLCLYII 135 + + L +F NI NL +V YV +W+ +CL + Sbjct: 311 VNSLLALTFQFGNIMRNLPRVSYVKALDVWMLVCLTFV 348 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,991,320 Number of Sequences: 27780 Number of extensions: 176662 Number of successful extensions: 290 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -