BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0723 + 5411327-5411929,5413290-5413721 31 0.56 06_01_0888 + 6805071-6805485,6806202-6806374,6806501-6806549,680... 28 5.2 >02_01_0723 + 5411327-5411929,5413290-5413721 Length = 344 Score = 31.1 bits (67), Expect = 0.56 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 229 YTSCAPMTPGVCAGGAALGDTPA 161 YT P PG A GAA G TPA Sbjct: 38 YTPATPAAPGAAAAGAAAGATPA 60 >06_01_0888 + 6805071-6805485,6806202-6806374,6806501-6806549, 6806654-6806820,6806919-6807002,6807097-6807135 Length = 308 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +3 Query: 255 AEQQARSTAQPIPEQLSFKEKMKMFALEAGDASTP 359 AE++A++ A+P PE + K+ M++ E G+ P Sbjct: 106 AERKAKAPAEPKPESSAGKDSMEVDKKEEGNVRKP 140 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,922,197 Number of Sequences: 37544 Number of extensions: 130415 Number of successful extensions: 456 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 456 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -