BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40383| Best HMM Match : IQ (HMM E-Value=0.00047) 27 9.4 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 35.5 bits (78), Expect = 0.027 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 291 PEQLSFKEKMKMFALEAGDASTPKDKVKISRAQRDI 398 PE L+FK+KMKMF + STP KVK S+ R++ Sbjct: 381 PESLAFKQKMKMF----NNESTPDQKVKTSKWHREM 412 >SB_40383| Best HMM Match : IQ (HMM E-Value=0.00047) Length = 841 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 222 EVYRDPRARRLAEQQARSTAQPI-PEQLSFKEKMKMF 329 EV ++ ARR+AEQ+ TA+ + EQ ++ +MF Sbjct: 633 EVLKEREARRVAEQERLQTARAVTAEQKKSRQADRMF 669 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,905,364 Number of Sequences: 59808 Number of extensions: 139539 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -