BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0703 - 10535082-10536779 27 6.9 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 27 9.1 >03_02_0703 - 10535082-10536779 Length = 565 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 498 YRNGGAGPVELIQLSPSLICISNFCIVSDYDNTKMTTFGSLTSSA 364 ++NG + E +LS S+ I +FC DY T TT +A Sbjct: 26 FKNGSSNAKEDGELSTSVKSIKSFCQPVDYRETCETTLEQTAGNA 70 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 440 AYRTSASSQITTIPR*QHSEA*LPPPNALHP 348 A R+S S + +P H LPPP HP Sbjct: 6 ALRSSVGSHSSALPPSYHHHRRLPPPQQQHP 36 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,521,316 Number of Sequences: 37544 Number of extensions: 218785 Number of successful extensions: 362 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -