BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS307B02f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 89 6e-20 AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 23 6.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 8.2 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 89.4 bits (212), Expect = 6e-20 Identities = 39/102 (38%), Positives = 64/102 (62%), Gaps = 1/102 (0%) Frame = +1 Query: 79 VIQNDAHFQTEMANAGTKLVVVDFTATWCPPCQRIAPFFEQLPAKFP-RAVFLKVDVDRC 255 ++++ F ++ AG +LVVVDF ATWC PC+ IAP E+ K+ + V +KVDVD C Sbjct: 4 MVKDSEDFNNKLEAAGDQLVVVDFFATWCGPCKVIAPKLEEFQNKYADKIVVVKVDVDEC 63 Query: 256 ADTASAQGVSAMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 381 + A+ +++MPTF+F + + + + G N LEN ++Q+ Sbjct: 64 EELAAQYNIASMPTFLFIKRKEVVGQFSGANAEKLENFIQQH 105 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 140 TTNLVPALAISVW 102 TT LVP L I VW Sbjct: 180 TTGLVPLLGIDVW 192 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 340 GGNTTVLENKVRQYYGSDVAEEDEDNTVAGHMDLIT 447 GG V+E + + + +EDE+N + G + +T Sbjct: 1566 GGGGGVVEETISSFKENIFLKEDENNFMRGEVPRMT 1601 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 482,264 Number of Sequences: 2352 Number of extensions: 7901 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -